[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56707.1"

            "conserved hypothetical protein"
            ""

OrgPattern ------1-1111111--------11--12-1111-111--111111111----11111111------- ---------------------1---------------1-----1----------------------11-------------------------------------------------------------------------111---111-------------------------------------------------------------------------------------------------------------------------------------------11111111111-------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1----------------------------------------------------1-----------------------------------------------------1------------------------------------------------------1111------1---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRNQLALSGEKILEKIYPQLFHHVGMIRGEYLLRELNQNIILASCQQFVKDYLETICSLY:Sequence :EEcTHHHHcHHHHHHHHHHHHcccHHHHHHHHHTTHHHHHEEHHHHHHHHHHTTEEEccc:Sec Str : =:RP:SCP|60->254|1dikA1|9e-21|20.3|192/365|c.1.12.2 : =====================================:BL:SWS|24->229|PPSA_PYRHO|2e-16|26.4|201/821 61: . . . * . .: 120 :SDEEVWYRFTELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVY:Sequence :cHHHHHcHHHHTTTccHHHHHHHHHTTccccTTccccTHHHHHHcHHHHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|60->254|1dikA1|9e-21|20.3|192/365|c.1.12.2 :============================================================:BL:SWS|24->229|PPSA_PYRHO|2e-16|26.4|201/821 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->229|PF02896|2e-09|27.9|140/300|PEP-utilizers_C 121: . . + . . .: 180 :QTNPNLSVIFPFVNDADQLKQAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIV:Sequence :cccGccEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHTHHHHHHHccEEEE:Sec Str :============================================================:RP:SCP|60->254|1dikA1|9e-21|20.3|192/365|c.1.12.2 :============================================================:BL:SWS|24->229|PPSA_PYRHO|2e-16|26.4|201/821 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->229|PF02896|2e-09|27.9|140/300|PEP-utilizers_C 181: . * . . . .: 240 :VGMNDLTSFVFATMRNSQWHDLESPIMLDMLRDMQDKARKNKINFAVAGYLNTSFIQKMN:Sequence :EEHHHHHHHHHTccHHHHHHHHHHTTHHHHHHHHHHHHHHHccEEEEEcTTcHHHHHHHH:Sec Str :============================================================:RP:SCP|60->254|1dikA1|9e-21|20.3|192/365|c.1.12.2 :================================================= :BL:SWS|24->229|PPSA_PYRHO|2e-16|26.4|201/821 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|89->229|PF02896|2e-09|27.9|140/300|PEP-utilizers_C 241: + . . . . *: 300 :QLGIKCIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRSTHDTARNVE :Sequence :HHTccEEEcTTTHHHHHHHHHHHHHHHccccccTTcccTTccccHHHHH :Sec Str :============== :RP:SCP|60->254|1dikA1|9e-21|20.3|192/365|c.1.12.2