[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56712.1"

            "oxidoreductase, aldo/keto reductase family"
            ""

OrgPattern 11213113444434422743413-722929A2----------------------11111122213--- 569-F21344525137611-13222511111135552776374DD8A2287-ABC21411425292D9A925455564-1123--11-541--1------14133A-22---------------11-1111--1-112232---7-24362252211---1--232684C3------------452--32173877777767467767744446876623636676777756D2666666666666666444838E36734535889988268588455333211113322222222222111-1111111112221111225--12411122222134-------3-21-332----1---13--22-12-11-1444------746541-34333211111111116-55458955761-BAA4AA7GD87665241111212233-3333333356553112------------------------------33326-66546555555212266862223238652434--332214--3-1-41141-1--2------------3211---1----2----2-12--31-345359-11-3---------3-------1--11112243331-42-12222121321221-1112--1-111------54662746888688877-7567886686889666668AAA66122748798887998788A756665661-655555545555-----1-1-1232112521-17-5---------2211212-113-66463444354451334---------1-112222221112222122222213-----16221211111-1-----3----1------1------5------1141-43343112 ----647-A532358C9BEJIIEIJJJ8854557879AAA89A666GEEKFJYMHIC87989D8A36C7656D4A5667668889875-RmL99PBDCCD75BKBC11mGeLJ788KA77CGAGQQ6S8b*E1JAN8774934UL74563H5A86A97F8745GHEDCDHTPDA43955r3349EJHNICJTBFA358T -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIK:Sequence :ccEEEcTTccEEEcccEEcccccccHHHHHHHHHHHHHTccEEEccGGGccHHHHHHHHH:Sec Str : ################## :PROS|39->56|PS00798|ALDOKETO_REDUCTASE_1|PDOC00061| :============================================================:RP:SCP|1->267|1a80A|3e-70|43.8|258/277|c.1.7.1 : ===========================================================:BL:SWS|2->266|GR_BACSU|6e-76|54.1|255/276 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->259|PF00248|1e-42|45.1|237/281|Aldo_ket_red 61: . . . * . .: 120 :DSGVPREELFVTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQW:Sequence :HHTccGGGcEEEEEEcGGGccHHHHHHHHHHHHHHHTcccccEEEEccccTTTHHHHcGG:Sec Str :============================================================:RP:SCP|1->267|1a80A|3e-70|43.8|258/277|c.1.7.1 :============================================================:BL:SWS|2->266|GR_BACSU|6e-76|54.1|255/276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->259|PF00248|1e-42|45.1|237/281|Aldo_ket_red 121: . . + . . .: 180 :KIRNAEVWRAMEDLYQEGKIRAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQV:Sequence :GTcHHHHHHHHHHHHHTTccccEEEEcccHHHHHHHHHHccccccEEEEEccTTcccHHH:Sec Str : ################## :PROS|131->148|PS00062|ALDOKETO_REDUCTASE_2|PDOC00061| :============================================================:RP:SCP|1->267|1a80A|3e-70|43.8|258/277|c.1.7.1 :============================================================:BL:SWS|2->266|GR_BACSU|6e-76|54.1|255/276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->259|PF00248|1e-42|45.1|237/281|Aldo_ket_red 181: . * . . . .: 240 :VAYCREKGILLEAWGPFGQGELFDSKQVQEIAANHGKSIAQIALAWSLAEGFLPLPKSVT:Sequence :HHHHHHHTcEEEEEcTTGGGTTTTcHHHHHHHHHHTccHHHHHHHHHHHTTcEEcccccc:Sec Str :============================================================:RP:SCP|1->267|1a80A|3e-70|43.8|258/277|c.1.7.1 :============================================================:BL:SWS|2->266|GR_BACSU|6e-76|54.1|255/276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->259|PF00248|1e-42|45.1|237/281|Aldo_ket_red 241: + . . . . *: 300 :TSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF :Sequence :HHHHHHHTccccccccHHHHHHHHTTccccccccTTTccc :Sec Str :=========================== :RP:SCP|1->267|1a80A|3e-70|43.8|258/277|c.1.7.1 :========================== :BL:SWS|2->266|GR_BACSU|6e-76|54.1|255/276 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|15->259|PF00248|1e-42|45.1|237/281|Aldo_ket_red