[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56832.1"

            "hypothetical protein"
Y154_STRZP  "RecName: Full=UPF0176 protein SPP_0154;"

OrgPattern -------------------------------------------------------------------- -----111111111-----------------------111--------1---111111--------------------------------------1--1-1121111-1111111111111111-------------------1-111-111--1111111111--111-1111111111111-1-----1-11111111111111111-1111111---211111111112-11111111111111111111----------------------1111111---1--1111111111111111111111111111111111----------------------------------------------------1111-11111--111111-----11111111111----------1--111111111111--111111----11111111111---1----1111111111111111111111111111111111-11111111111111111111111111111111111111112--12211-22-1111---------------1-------------------------------------------------------------11111111-111111-111111111111------1111111111-111111111111-11111111111111111111111111-111111111111111111-1111111111111111111--11111111111-1111---------------1111111111-111111111111111111111111111-1--111111111--11111111111111----111111----------11111---------------------------------- --------------1--------------------------------1-------------------------------------------------------332--2-2111-1111111113112-4E1-32311111-1111111-1-1111111111-2-----------1122B333114335-426775554 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKY:Sequence : cccTTcccTTccccHHHHHHHHHHTTccTTcEEEEEcccTTccccHHHHHHH:Sec Str : ======================================================:RP:SCP|7->89|1mwqA|3e-09|23.5|81/100|d.58.4.7 :============================================================:BL:SWS|1->328|Y154_STRZP|0.0|99.7|328/328 61: . . . * . .: 120 :MDYVHSLPGMEELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYL:Sequence :HHHTTcccEEEEETHHHHHHHTTccccccccccccccccccccGGGEEccGGGTTcccEE:Sec Str :============================= :RP:SCP|7->89|1mwqA|3e-09|23.5|81/100|d.58.4.7 : ==:RP:SCP|119->253|1yt8A3|5e-21|17.5|126/157|c.46.1.2 :============================================================:BL:SWS|1->328|Y154_STRZP|0.0|99.7|328/328 121: . . + . . .: 180 :SPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRV:Sequence :cHHHHHTTTTcTTEEEEEcccHHHHHHcccTTcEEccGGGGHHHHHHHHHHTccTTcEEE:Sec Str :============================================================:RP:SCP|119->253|1yt8A3|5e-21|17.5|126/157|c.46.1.2 :============================================================:BL:SWS|1->328|Y154_STRZP|0.0|99.7|328/328 181: . * . . . .: 240 :VVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVD:Sequence :EEcccccHHHHHHHHHHHHTTcccEEEETTHHHHHHHcGTTccccccccccccccccccc:Sec Str :============================================================:RP:SCP|119->253|1yt8A3|5e-21|17.5|126/157|c.46.1.2 :============================================================:BL:SWS|1->328|Y154_STRZP|0.0|99.7|328/328 241: + . . . . *: 300 :VNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRY:Sequence :ccTTcccHHHHHHHTTcTTEEEEEcccHHHHTTccccccccccEEEccccHHHHHHHHHH:Sec Str :============= :RP:SCP|119->253|1yt8A3|5e-21|17.5|126/157|c.46.1.2 :============================================================:BL:SWS|1->328|Y154_STRZP|0.0|99.7|328/328 : $$$$$$$$$$:RP:PFM|291->318|PF12368|4e-07|75.0|28/28|DUF3650 301: . . . . + .: 360 :VSKNELTQAEVIERLAAIGESLDQAATV :Sequence :HHH :Sec Str :============================ :BL:SWS|1->328|Y154_STRZP|0.0|99.7|328/328 :$$$$$$$$$$$$$$$$$$ :RP:PFM|291->318|PF12368|4e-07|75.0|28/28|DUF3650