[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56832.1 spne4 ACF56832.1 "hypothetical protein"
MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKY
MDYVHSLPGMEELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYL
SPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRV
VVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVD
VNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRY
VSKNELTQAEVIERLAAIGESLDQAATV
//