[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56871.1"

            "IS630-SpnII, transposase"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4442343-234--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGKSYKEIIELLDCNQTTIWRNVKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHL:Sequence : cccHHHHHHHHTccHHHHHHHHHHHHHTTcEEcccEEETTTEEEcccccccccHHHHHH:Sec Str : ========================================= :RP:SCP|2->42|2oa4A1|2e-05|14.6|41/93|a.4.12.3 61: . . . * . .: 120 :KATEAGEFVTIDALFQVYKKECG :Sequence :HHHHH :Sec Str