[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:argR1"

argR1       "arginine repressor"
            ""

OrgPattern -------------------------------------------------------------------- 111--11111111111111-1111-111111-11111-11-11111-11---1111-1--111111211111111111-1----------11-1-------------------------------111-1-------------------------------------------------------111---111111112212112221112211221111111111111111122222222222222111114-2-22-2---22222221112-111222222121122223322232212222222222122211122221-111---11-11111-111111111-1111111111111-1111111--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSA:Sequence :cccHHHHHHHHHHHHHHcccccHHHHHHHHHHTTccccHHHHHHHHHHTTcEEEEccccE:Sec Str : ======================================================:RP:SCP|7->76|1b4aA1|3e-17|41.4|70/75|a.4.5.3 :============================================================:BL:SWS|1->156|ARGR_STRSU|7e-58|64.7|156/157 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->61|PF01316|2e-10|50.8|59/69|Arg_repressor 61: . . . * . .: 120 :YYVLNNGSISKWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIA:Sequence :EEEcTTcccccHHHHHHHHHHHHEEEEEEETTEEEEEEcTTcHHHHHHHHHHHccTTEEE:Sec Str :================ :RP:SCP|7->76|1b4aA1|3e-17|41.4|70/75|a.4.5.3 : =======================================:RP:SCP|82->148|1b4bA|1e-16|32.8|67/72|d.74.2.1 :============================================================:BL:SWS|1->156|ARGR_STRSU|7e-58|64.7|156/157 :$ :RP:PFM|3->61|PF01316|2e-10|50.8|59/69|Arg_repressor : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|94->147|PF02863|5e-10|40.7|54/70|Arg_repressor_C 121: . . + . . .: 180 :TLCGNDVCLIICEDADTAQKCFEELKKFAPPFFFEE :Sequence :EEEcccEEEEEEccHHHHHHHHHHHHTT :Sec Str :============================ :RP:SCP|82->148|1b4bA|1e-16|32.8|67/72|d.74.2.1 :==================================== :BL:SWS|1->156|ARGR_STRSU|7e-58|64.7|156/157 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|94->147|PF02863|5e-10|40.7|54/70|Arg_repressor_C