[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:asd"

asd         "aspartate-semialdehyde dehydrogenase"
            ""

OrgPattern ---1---111111111--1111111111111111111111111----1-11111------1---1--1 1111211111111111111-11111111111111111111121111111111------1122111112221-111---11111111111111111111111111111111---------------11111111111-----111-111111111111111111111111111111111111111111111111122222222122222211111122211111111111111-1111111111111111111111-1111111-121111--1111111111111111111111111111-------------1111111111111-11111111111-1111111-11-11--11111111121111111-1111222111111112221111111111111111111-111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------------------------1-11---1---111---1--1-1111111111212-1-1111121211211111111111111111111111111122111-111111111111111111111111---11111--11111112111111111111-1111111111111111111111112121111111111111111111111111-111111111111--2111111111112-1-111-1----11---1-------11-1-11111111111111111111--111112222222222222211111111111111111111--------------1-------------------------1111111111111 ------1-----11------------------------------------------------1---1-111111111-11111-11---------1--------1---1----------------------------------------------------------------1-1111E112111113-111121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTET:Sequence : HHHHHHHHHTGGcEEEEEcccccTTcccccTTccccccccTTcH:Sec Str : XXXXXXXXXXXXXXX :SEG|2->16|gytvavvgatgavga : XXXXXXXXX:SEG|52->60|itieettet : ============================================:RP:SCP|17->155|2gyyA1|5e-31|73.9|134/150|c.2.1.3 : ============================================:BL:SWS|17->358|DHAS_STRMU|e-150|75.7|342/358 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->118|PF01118|2e-07|36.0|89/120|Semialdhyde_dh 61: . . . * . .: 120 :AFEGVDIALFSAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN:Sequence :HHHTccEEEEcccHHHHHHHHHHHHTcccEEEEcccTTTTcTTEEEEcHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|17->155|2gyyA1|5e-31|73.9|134/150|c.2.1.3 :============================================================:BL:SWS|17->358|DHAS_STRMU|e-150|75.7|342/358 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|29->118|PF01118|2e-07|36.0|89/120|Semialdhyde_dh 121: . . + . . .: 180 :GIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGV:Sequence :cEEEEccHHHHHHHHHHHHHHTTTcEEEEEEEEEEccTTTcHHHHHHHHHHHHHHHHTTH:Sec Str :=================================== :RP:SCP|17->155|2gyyA1|5e-31|73.9|134/150|c.2.1.3 : =====================================================:RP:SCP|128->329|2gyyA2|4e-25|91.1|202/202|d.81.1.1 :============================================================:BL:SWS|17->358|DHAS_STRMU|e-150|75.7|342/358 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|137->328|PF02774|2e-19|40.5|163/165|Semialdhyde_dhC 181: . * . . . .: 240 :KPRDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVS:Sequence :HHHHHHHHHHHHHHTTTcccccTTTccccTTcccccccccccccHHHHHHHTTcccccEE:Sec Str : XXXXXXXXXXXXXXXXX :SEG|217->233|ytyeemkmtketkkime :============================================================:RP:SCP|128->329|2gyyA2|4e-25|91.1|202/202|d.81.1.1 :============================================================:BL:SWS|17->358|DHAS_STRMU|e-150|75.7|342/358 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|137->328|PF02774|2e-19|40.5|163/165|Semialdhyde_dhC 241: + . . . . *: 300 :ATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSR:Sequence :EEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHcTTccccHHHHHHHccHHHHTTcc:Sec Str :============================================================:RP:SCP|128->329|2gyyA2|4e-25|91.1|202/202|d.81.1.1 :============================================================:BL:SWS|17->358|DHAS_STRMU|e-150|75.7|342/358 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|137->328|PF02774|2e-19|40.5|163/165|Semialdhyde_dhC 301: . . . . + .: 360 :DTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPTAELKFELK :Sequence :cccEEEEEEcTTcTTEEEEEEEEETTcccccHHHHHHHHHHHHHHHHHHHTTcccccc :Sec Str :============================= :RP:SCP|128->329|2gyyA2|4e-25|91.1|202/202|d.81.1.1 :========================================================== :BL:SWS|17->358|DHAS_STRMU|e-150|75.7|342/358 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|137->328|PF02774|2e-19|40.5|163/165|Semialdhyde_dhC