[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:atpA"

atpA        "ATP synthase F0, A chain"
ATP6_STRP4  "RecName: Full=ATP synthase subunit a;AltName: Full=F-ATPase subunit 6;AltName: Full=ATP synthase F0 sector subunit a;"

OrgPattern --------------------------------------------------11---------------- 11--111111111-11111-1111111111111111-1111-11--111-----------11---1111-1---------1-1--111--------1---11-------1--------------121--1112-11---------122-1111111111111121111111111111111111-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-1111-------1-11-11-1111-1--121111111111111--1--11-11----111112---1--1---11------------11-11-1--------1111--11111---11-1-11111111111111----121111-1---------11-111111111111------1111-------12122--11222211--21-11-1--111--111-2----11-1--11------122111-211112-111---1------111----1-21111111111111111111111111111-11-11112-211111121111111111111-1111111-111-1111111-11111111-11111111111111111111111111111111111111111111-11---1111------1------1111111-111--2121111111111111111111111111111111111111111111111111111111112111112121111111111111111--1-----------------1----------------------11-1111111111-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------4----1----------31--1-------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNILEYVYDFV:Sequence : :Sec Str :============================================================:BL:SWS|1->238|ATP6_STRP4|e-136|100.0|238/238 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->229|PF00119|6e-14|34.0|200/215|ATP-synt_A 61: . . . * . .: 120 :IGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLT:Sequence : :Sec Str : ===============================================:RP:SCP|74->229|1c17M|1e-24|23.4|137/142|f.18.1.1 :============================================================:BL:SWS|1->238|ATP6_STRP4|e-136|100.0|238/238 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->229|PF00119|6e-14|34.0|200/215|ATP-synt_A 121: . . + . . .: 180 :LSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEV:Sequence : HHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|74->229|1c17M|1e-24|23.4|137/142|f.18.1.1 :============================================================:BL:SWS|1->238|ATP6_STRP4|e-136|100.0|238/238 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->229|PF00119|6e-14|34.0|200/215|ATP-synt_A 181: . * . . . .: 240 :MTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE :Sequence :HHHHHHHHccccHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHc :Sec Str :================================================= :RP:SCP|74->229|1c17M|1e-24|23.4|137/142|f.18.1.1 :========================================================== :BL:SWS|1->238|ATP6_STRP4|e-136|100.0|238/238 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|18->229|PF00119|6e-14|34.0|200/215|ATP-synt_A