[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:atpC"

atpC        "ATP synthase F0, C chain"
ATPL_STRZT  "RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c;         Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV:Sequence : GGGHHHHHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : ###################### :PROS|31->52|PS00605|ATPASE_C|PDOC00526| : ================================================:RP:SCP|13->65|1ijpA|7e-10|20.8|53/79|f.17.1.1 :============================================================:BL:SWS|1->66|ATPL_STRZT|1e-33|100.0|66/66 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->65|PF00137|6e-04|28.3|60/70|ATP-synt_C 61: . . . * . .: 120 :FSFIIK :Sequence :HHHHH :Sec Str :===== :RP:SCP|13->65|1ijpA|7e-10|20.8|53/79|f.17.1.1 :====== :BL:SWS|1->66|ATPL_STRZT|1e-33|100.0|66/66 :$$$$$ :RP:PFM|6->65|PF00137|6e-04|28.3|60/70|ATP-synt_C