[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:gatB"

gatB        "Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit"
GATB_STRP4  "RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;         Short=Asp/Glu-ADT subunit B;         EC=6.3.5.-;"

OrgPattern 22121222222222221-111112211222212222222222211111122222-1-11-11-11212 1111111111111111111-1111111111111111111111111111111111111111111111111111111111-111111111--------1--------1112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-2111111111111-111---11211111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111211----11--------------------------11111---------------------------------------------------------------------------------------------11111111111111---------------111111111111111111111111111111111111111----------------------------11111111111111111111-----1-11111111111111111111111111111111 11--111-1-----1111111111111111111111111111111111111111111-1111111111111111121-1111111112-1211111111-111111-1-1121112111111113-111181-1111111211211111111111111113111111111A11-11-12E2221111131421111112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGI:Sequence :cccEEEEEEEEEEEccccccccccccccccccTTccccTTTTTcTTccccccHHHHHHHH:Sec Str : ===========================================================:RP:SCP|2->295|2df4B2|e-138|70.2|292/292|d.128.1.5 :============================================================:BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->290|PF02934|e-103|61.8|285/288|GatB_N 61: . . . * . .: 120 :KAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIE:Sequence :HHHHTTTcEEccEEccEEEEcccTTcTTcEEEEccccccEEEEEEEEEcccccEEEEEEE:Sec Str :============================================================:RP:SCP|2->295|2df4B2|e-138|70.2|292/292|d.128.1.5 :============================================================:BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->290|PF02934|e-103|61.8|285/288|GatB_N 121: . . + . . .: 180 :RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAG:Sequence :EEEEEEcccEEEccTTTccEEETTcTTcEEEEEEEcTTcccHHHHHHHHHHHHHHHHHHT:Sec Str : ############### :PROS|143->157|PS01234|GATB|PDOC00948| :============================================================:RP:SCP|2->295|2df4B2|e-138|70.2|292/292|d.128.1.5 :============================================================:BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->290|PF02934|e-103|61.8|285/288|GatB_N 181: . * . . . .: 240 :ISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEILRSG:Sequence :cccccTTTTcEEEEEEEEEEcTTccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHc:Sec Str :============================================================:RP:SCP|2->295|2df4B2|e-138|70.2|292/292|d.128.1.5 :============================================================:BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->290|PF02934|e-103|61.8|285/288|GatB_N 241: + . . . . *: 300 :GQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLFEIXDEWIEEMRTELPEFPKE:Sequence :ccccEEEEEEcTTTccEEEEEEcccccccccEEcTTcccEEccHHHHHHHHHTccccHHH:Sec Str :======================================================= :RP:SCP|2->295|2df4B2|e-138|70.2|292/292|d.128.1.5 : =====:RP:SCP|296->402|2df4B1|5e-30|55.1|107/107|a.182.1.2 :============================================================:BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->290|PF02934|e-103|61.8|285/288|GatB_N 301: . . . . + .: 360 :RRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEVAQFLNAEGKT:Sequence :HHTTTTcTTccccHHHHHHcccHHHHHHHHHHHHHTccHHHHHHHHHTTHHHHHHHHTcc:Sec Str :============================================================:RP:SCP|296->402|2df4B1|5e-30|55.1|107/107|a.182.1.2 :============================================================:BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->465|PF02637|9e-30|47.8|138/148|GatB_Yqey 361: . . . * . .: 420 :LEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL:Sequence :cTTTcccHHHHHHHHHHHHTTcccGGGHHHHHHHHHHcccccTTHHHTTccccccHHHHH:Sec Str :========================================== :RP:SCP|296->402|2df4B1|5e-30|55.1|107/107|a.182.1.2 :============================================================:BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->465|PF02637|9e-30|47.8|138/148|GatB_Yqey 421: . . + . . .: 480 :IPIIHQVFADNEAAVVDFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKEN:Sequence :HHHHTTcTTTcccHHHHHTTTTHHHHHHHHHHHTTcccccGGGH :Sec Str : XXXXXXXXXXXXXX :SEG|466->479|alkllaqelaklke :============================================= :BL:SWS|1->465|GATB_STRP4|0.0|100.0|465/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|328->465|PF02637|9e-30|47.8|138/148|GatB_Yqey