[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56666.1 spne4 gatB "Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit"
MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGI
KAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAG
ISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEILRSG
GQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLFEIXDEWIEEMRTELPEFPKE
RRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEVAQFLNAEGKT
LEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
IPIIHQVFADNEAAVVDFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKEN
//