[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:greA"

greA        "transcription elongation factor GreA"
GREA_STRZT  "RecName: Full=Transcription elongation factor greA;AltName: Full=Transcript cleavage factor greA;"

OrgPattern -------------------------------------------------------------------- 12211------111-1111-1---1-111111-111-1--111-1--11---1111-111111-1111111111111111111-----111111111-1111111111111111111---11111111111111111111111112-------------------------------------11111--1111111111111111111111111111111111211111112111111111111111111111222222222222222212211111111111111111111111111111111111111111111111111111212222122222112211112111122211111111111111111--111111111111121111111111111111111111-11111111111111111111111111111111111111111111111122222211111111111111111111111111111112212222222222222222222222222222222222222222222222222212222233212222222222222211111111111111323323213222122121111111111111111111121111111121212221122222211111121111221-1111111111122111221111111111-111111111111111111122211112221222222222222221111112112222222122221111111111111122122222221222222222222211111212222212221111212111111111121111111111111122111111111111111111111111111111111111-1-1111111111111111111111111111111- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAEKTYPMTLEEKEKLEKELEELKLVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFV:Sequence : ccccEEEHHHHHHHHHHHHcGGGTTcHHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|10->25|leekeklekeleelkl : ################################ :PROS|19->50|PS00829|GREAB_1|PDOC00651| : =========================================================:RP:SCP|4->80|1grjA1|2e-14|36.4|77/78|a.2.1.1 :============================================================:BL:SWS|1->160|GREA_STRZT|6e-75|100.0|160/160 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->76|PF03449|4e-10|60.8|51/73|GreA_GreB_N 61: . . . * . .: 120 :EGQISSLETKIRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGK:Sequence :HHHHHHHHHHHHTcEEEcGGGccTTcccTTcEEEEEETTTccEEEEEEEcGGGcccTTTE:Sec Str :==================== :RP:SCP|4->80|1grjA1|2e-14|36.4|77/78|a.2.1.1 : ====================================:RP:SCP|85->157|2etnA2|2e-15|26.0|73/79|d.26.1.2 :============================================================:BL:SWS|1->160|GREA_STRZT|6e-75|100.0|160/160 :$$$$$$$$$$$$$$$$ :RP:PFM|26->76|PF03449|4e-10|60.8|51/73|GreA_GreB_N : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|83->157|PF01272|3e-12|46.7|75/78|GreA_GreB 121: . . + . . .: 180 :VSNESPIGQALIGKKTGDTATIETPVGSYDVKILKVEKTA :Sequence :EETTcHHHHHHTTccTTcEEEEEETTTEEEEEEEEEE :Sec Str : ################# :PROS|122->138|PS00830|GREAB_2|PDOC00651| :===================================== :RP:SCP|85->157|2etnA2|2e-15|26.0|73/79|d.26.1.2 :======================================== :BL:SWS|1->160|GREA_STRZT|6e-75|100.0|160/160 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|83->157|PF01272|3e-12|46.7|75/78|GreA_GreB