[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:metB"

metB        "cystathionine gamma-synthase (CGS) (O-succinylhomoserine(thiol)-lyase)"
            ""

OrgPattern 22-1-11111111111-111111-3332233321--------1451-1-1221-111-1--2221--- 1741421233222144433-34223533333244443567133365423442446565--324-433334346664441-131-----33222211---11435442344---------------2323322431144444---43---2--1--11332321----2-1-22222232223234322--12435555555555555556633435553453511333333752333333333333323334422-11113-1-331112-1-253323-------222122221211111111111112111222333222-241573333333231227721113241-5333-22--1-242333321316-33334-----35867543B567544444443446156755836783-555666665866443543434544345222222224222335811-----------------------11112346424643463344754444333844441453465441143333455635664323111343222222222244221123-2-241----565354423445442113231122212112111111123121113332314434335455444444544355442--3321------52332332222222222-2222222232222222223333334462222222222222222422222222-32233333333322-311111111112214333333-22212223333332312231333344251656424221--------12223222222332233232333331111113122--11--------1----------------------------11--22222-22 ----113-631-5645554667556655544344646444444444445538965544444455544425534545534555554433-57454483222323433-3624151121111111122111372-2131121111211111111111111111135241112233323235n4442365685643342225 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKELHINTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAE:Sequence :ccccccHHHHHHHTTccccTTTcccccccccccccccccccHHHHHHccccccHHHHHHH:Sec Str : =======================================================:RP:SCP|6->363|1cs1A|7e-61|40.2|358/384|c.67.1.3 :============================================================:BL:SWS|1->361|METB_HAEIN|6e-92|47.4|361/369 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->362|PF01053|3e-76|46.6|354/384|Cys_Met_Meta_PP 61: . . . * . .: 120 :EVLATIESADYALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHF:Sequence :HHHHHHHTccEEEEEccHHHHHHHHHTTccTTcEEEEEccccHHHHHHHHHHHHHHHEEE:Sec Str :============================================================:RP:SCP|6->363|1cs1A|7e-61|40.2|358/384|c.67.1.3 :============================================================:BL:SWS|1->361|METB_HAEIN|6e-92|47.4|361/369 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->362|PF01053|3e-76|46.6|354/384|Cys_Met_Meta_PP 121: . . + . . .: 180 :TYANTEEELIAELEKDVDVLYIETPTNPLMLEFDIEKLAKLAHAKGAKVVVDNTFYSPIY:Sequence :EcTTcHHHHHHHccTTEEEEEEEcccTTTcccccHHHHHHHHHHTTcEEEEEcccccTTT:Sec Str : XXXXXXXXXXXXXXX :SEG|157->171|klaklahakgakvvv :============================================================:RP:SCP|6->363|1cs1A|7e-61|40.2|358/384|c.67.1.3 :============================================================:BL:SWS|1->361|METB_HAEIN|6e-92|47.4|361/369 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->362|PF01053|3e-76|46.6|354/384|Cys_Met_Meta_PP 181: . * . . . .: 240 :QRPIEDGADIVLHSATKYLAGHNDVLAGVVVTNSLELYEKLFYNLNTTGAVLSPFDSYQL:Sequence :ccGGGGTccEEEEETTTTTTcccccccEEEEEcccHHHHHHHHHHHHHcccccHHHHHHH:Sec Str : ############### :PROS|189->203|PS00868|CYS_MET_METAB_PP|PDOC00677| :============================================================:RP:SCP|6->363|1cs1A|7e-61|40.2|358/384|c.67.1.3 :============================================================:BL:SWS|1->361|METB_HAEIN|6e-92|47.4|361/369 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->362|PF01053|3e-76|46.6|354/384|Cys_Met_Meta_PP 241: + . . . . *: 300 :LRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRGGMISFKVADETRIPHILNSL:Sequence :HHHHTTHHHHHHHHHHHHHHHHHHHHTcTTEEEEEcTTcccEEEEEETHHHHHHHHHHHc:Sec Str :============================================================:RP:SCP|6->363|1cs1A|7e-61|40.2|358/384|c.67.1.3 :============================================================:BL:SWS|1->361|METB_HAEIN|6e-92|47.4|361/369 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->362|PF01053|3e-76|46.6|354/384|Cys_Met_Meta_PP 301: . . . . + .: 360 :KVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIEDARDLIADLRQ:Sequence :cccEEcccccccccEEEcTTTTTTcccccTTTTTccccccEEEEEcccccHHHHHHHHTT:Sec Str :============================================================:RP:SCP|6->363|1cs1A|7e-61|40.2|358/384|c.67.1.3 :============================================================:BL:SWS|1->361|METB_HAEIN|6e-92|47.4|361/369 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->362|PF01053|3e-76|46.6|354/384|Cys_Met_Meta_PP 361: . . . * . .: 420 :ALEG :Sequence :cTHH :Sec Str :=== :RP:SCP|6->363|1cs1A|7e-61|40.2|358/384|c.67.1.3 := :BL:SWS|1->361|METB_HAEIN|6e-92|47.4|361/369 :$$ :RP:PFM|8->362|PF01053|3e-76|46.6|354/384|Cys_Met_Meta_PP