[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:pfkA"

pfkA        "6-phosphofructokinase"
K6PF_STRPI  "RecName: Full=6-phosphofructokinase;         Short=Phosphofructokinase;         EC=2.7.1.11;AltName: Full=Phosphohexokinase;"

OrgPattern -----------------2-------------------------1--22-------------------- 131-211111111111111-11112-1111111111111112222-111111121111--11-21113321-------1-1-21-1113345-311---11112111122---------------1121211222422233---212122222-111------121-121-------------11111222111111111111111111211111111111-111111111111111111111111111111111-2112-11111--11111---11111111111111111111111111111111111111141111111211131111111111211113332111112222222222112211123111-1-----------1--1-----------------------------1-----------------------------------------111--------------------------------1----------------------------------------11-111--1----2--------------11--1121211211--111133322232111112332--------------------11111--1111--112-2-------------------1------11111111111111111111111-1111111111111111111222221111111111111111111211111111-111111111111111-222221111-1---111111111111111---------------------------------------11111111111111----------------11111111---1--11--111111---1111111111111111123222232221-2 --11111-211-1111111111121221111111111111111111211111111111111112222212322222213222222211-1211111111111122211113896953323233334273Dp4-965222363351-331132233633213A42111311223112221H2221275651622-11--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI:Sequence :ccEEEEEEEccccHHHHHHHHHHHHHHHHHTcEEEEEEEcTTcHHHHHHHHHHHTTccEE:Sec Str :============================================================:RP:SCP|1->335|1mtoA|5e-91|61.9|318/319|c.89.1.1 :============================================================:BL:SWS|1->335|K6PF_STRPI|0.0|100.0|335/335 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->274|PF00365|2e-64|52.4|271/282|PFK 61: . . . * . .: 120 :ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI:Sequence :EEEccccHHHHHHHHHHTTTccEEEccccTTccccEEEEcHHHHHHHHHHHHHHHTcccE:Sec Str : XXXXXXXXXXXX :SEG|93->104|giegvvviggdg :============================================================:RP:SCP|1->335|1mtoA|5e-91|61.9|318/319|c.89.1.1 :============================================================:BL:SWS|1->335|K6PF_STRPI|0.0|100.0|335/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->274|PF00365|2e-64|52.4|271/282|PFK 121: . . + . . .: 180 :GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA:Sequence :EEEEccTTcHHHHHHHHHHHHHHHHTccccEEEEccccHHHHHHHHHHHccccEEEEccH:Sec Str :============================================================:RP:SCP|1->335|1mtoA|5e-91|61.9|318/319|c.89.1.1 :============================================================:BL:SWS|1->335|K6PF_STRPI|0.0|100.0|335/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->274|PF00365|2e-64|52.4|271/282|PFK 181: . * . . . .: 240 :GIATGADEIIIPEADFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT:Sequence :HHHHHHHEHHHHHTTcccTTTcEEEEEEccGGGGGcccccEEEEccHHHHHHHHHHHEEE:Sec Str :============================================================:RP:SCP|1->335|1mtoA|5e-91|61.9|318/319|c.89.1.1 :============================================================:BL:SWS|1->335|K6PF_STRPI|0.0|100.0|335/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->274|PF00365|2e-64|52.4|271/282|PFK 241: + . . . . *: 300 :SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT:Sequence :EccEEEcccccccTTccTTcHHHHHHHHHHHHHHTTccccTTEEEEETTTEEEEccTccc:Sec Str : ################### :PROS|244->262|PS00433|PHOSPHOFRUCTOKINASE|PDOC00336| :============================================================:RP:SCP|1->335|1mtoA|5e-91|61.9|318/319|c.89.1.1 :============================================================:BL:SWS|1->335|K6PF_STRPI|0.0|100.0|335/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->274|PF00365|2e-64|52.4|271/282|PFK 301: . . . . + .: 360 :AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS :Sequence :ccGGGcccTTTGGGcEEEcTTccEEEGGGcHHHHT :Sec Str :=================================== :RP:SCP|1->335|1mtoA|5e-91|61.9|318/319|c.89.1.1 :=================================== :BL:SWS|1->335|K6PF_STRPI|0.0|100.0|335/335