[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:prfC"

prfC        "peptide chain release factor 3"
RF3_STRP4   "RecName: Full=Peptide chain release factor 3;         Short=RF-3;"

OrgPattern 1111111111111111111111111-111111--111------11111-11112111111111-1111 4443733333233332234-4333334444424333334433334422444224332422335332455342444343444422333365552555312545444634542222222222222245544454454544433444435565665344444444466455556444444444444555333334334444444434444445333334443335444444444564644444444445434444445544445545665544454444545544444444444455545545433444444543446544474544556666666666566555666665644556536645343434444334453544455444444565554555554444444444414444454455435554454555444444444454654444444444444444565333333332322333333333333333333445455554544454444344445644444444566653455555444555555445454444444444444455556666666566666456656666677776666433333343333333333333333344444545545556555555655556455565214544444244444444544444444444-44444444444444444445554544444444444443444445444443342544444444444224444444444454645433444444434444444444444445555554444555544444444444444555655555565665544444444444444535556553223333343422223-23322222222322222223333333333253 67--443-C43-4532232333333333333333333333333333213333333332333333344423343334522543333333-32323432222222332-4A455633482333233883719I5-457322251342332-132262523648C25232334I33635666*76454A58D1887697546 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIE:Sequence :TTccccGccEEEEEEEEcTTccHHHHHHHHHHHTTcccccccGGGTccccHHHHcccHHH:Sec Str : ######:PROS|55->70|PS00301|EFACTOR_GTP|PDOC00273| :============================================================:RP:SCP|1->265|1darA2|6e-53|29.7|229/254|c.37.1.8 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->143|PF00009|6e-18|35.2|128/183|GTP_EFTU 61: . . . * . .: 120 :KQRGISVTSSVMQFDYDGKRVNXLDTPGHEDFSEDTYRTLMAVDAAVMVVDSAKGIEAQT:Sequence :HHTTcccccEEEEEEETTEEEEEEEccccGGGHHHHHHHHHHccEEEEEEETTTcccHHH:Sec Str : XXXXXXXXXXXXX :SEG|101->113|mavdaavmvvdsa :########## :PROS|55->70|PS00301|EFACTOR_GTP|PDOC00273| :============================================================:RP:SCP|1->265|1darA2|6e-53|29.7|229/254|c.37.1.8 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->143|PF00009|6e-18|35.2|128/183|GTP_EFTU 121: . . + . . .: 180 :XKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLY:Sequence :HHHHHHHHHTTccEEEEEEcGGGcccHHHHHHHHHHHHccEEEEEcEEEEEETTEEEEEE:Sec Str :============================================================:RP:SCP|1->265|1darA2|6e-53|29.7|229/254|c.37.1.8 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|11->143|PF00009|6e-18|35.2|128/183|GTP_EFTU 181: . * . . . .: 240 :DLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELLNEAGNEFSEEAILAGELT:Sequence :ETTTTEEEEETTEEEEEcccGGGHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHTTccE:Sec Str :============================================================:RP:SCP|1->265|1darA2|6e-53|29.7|229/254|c.37.1.8 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 241: + . . . . *: 300 :PVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDPYDKDFSGFVFKIQANMDPRH:Sequence :EEEEccTTTTccHHHHHHHHHHHcccHHHHcccTccEEEHcccccEEEEEEEEEETccTT:Sec Str :========================= :RP:SCP|1->265|1darA2|6e-53|29.7|229/254|c.37.1.8 : ========================================================:RP:SCP|245->380|1n0uA1|5e-16|18.5|124/138|b.43.3.1 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 301: . . . . + .: 360 :RDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVAGDIIGVYDTG:Sequence :TEEEEEEEEEEcEEcTTEEEccTTccEEEEEccEEEEETTEEEEEccEETTcEEEEcccT:Sec Str :============================================================:RP:SCP|245->380|1n0uA1|5e-16|18.5|124/138|b.43.3.1 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 361: . . . * . .: 420 :TYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKN:Sequence :TccTTcEEEccccGGGccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHcTTcEEEc:Sec Str :==================== :RP:SCP|245->380|1n0uA1|5e-16|18.5|124/138|b.43.3.1 : ====================================:RP:SCP|385->455|1fnmA4|1e-14|18.3|71/79|d.58.11.1 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 421: . . + . . .: 480 :YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNXL:Sequence :TTTccEEEEEccHHHHHHTHHHHHHHTTccEEEEccccccEEEEcccEEEEEEEEEEEEE:Sec Str :=================================== :RP:SCP|385->455|1fnmA4|1e-14|18.3|71/79|d.58.11.1 :============================================================:BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514 481: . * . . . .: 540 :AKDRFDQPVFLFENDFALRWFADKYPDVELEEKM :Sequence :EEEEEEccccEEEEcccTTcccGGGHHHEEEc :Sec Str :================================== :BL:SWS|1->514|RF3_STRP4|0.0|100.0|514/514