[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56317.1 spne4 prfC "peptide chain release factor 3"
MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIE
KQRGISVTSSVMQFDYDGKRVNXLDTPGHEDFSEDTYRTLMAVDAAVMVVDSAKGIEAQT
XKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLY
DLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELLNEAGNEFSEEAILAGELT
PVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDPYDKDFSGFVFKIQANMDPRH
RDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVAGDIIGVYDTG
TYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKN
YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNXL
AKDRFDQPVFLFENDFALRWFADKYPDVELEEKM
//