[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:radC"

radC        "DNA repair protein RadC"
RADC_STRZT  "RecName: Full=DNA repair protein radC homolog;"

OrgPattern -------------------------------------------11111-1111--------------- ----------------------------------------------------------------------------------11-1111222-1111--11411112112--------------1111221111-2111112221111111111111------11111111-----------------1112-11111111211111111111111112123111111111112111-1111111111111111111111111111111111111-11111111111111111111111111111111111111211111111112111111111111111112112121211111112222111111131111223-1111111111111111111111111111111-111111-11-1--111111111111-1-112211211111111111121111-1111111111-111--11-11---11-3-43-1111111113111111111112211111111111111--11121112312111132111111111111111212211132111111111111-32-2125111-1111-----------------------1111232111211111111211121121111111--12113------11231113111311111-12322111111111131111212222221211111111111112111111---111121111232--11-1-111111-151111111-2211-111111111-11112112111122212211111---------11311222322121411211111111111--11--1111--------1-1-------------------------1-11111111-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTD:Sequence : HHTTcccccGGGGGGcccccccHHHHHHTccccHHTccHH HHHHHHHHHccHHH:Sec Str : ====================:RP:SCP|41->119|2axtU1|5e-04|10.8|74/98|a.60.12.2 :============================================================:BL:SWS|1->226|RADC_STRZT|e-114|100.0|226/226 61: . . . * . .: 120 :LKKMTLQELQSLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGD:Sequence :HTTccHHHHTTcTTccHHHHHHHHHHHHHHHHH HTTcccc:Sec Str :=========================================================== :RP:SCP|41->119|2axtU1|5e-04|10.8|74/98|a.60.12.2 :============================================================:BL:SWS|1->226|RADC_STRZT|e-114|100.0|226/226 : $$$$$$$$$$$$$$$$$:RP:PFM|104->222|PF04002|2e-20|38.7|119/123|DUF2466 121: . . + . . .: 180 :KKQEHLVALYLNTQNQIIHQQTIFIGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGA:Sequence :TTccEEEEEEEcTTccEEEEEEEEcccccGGGccHHHHHHHHHHTTccEEEEEEEcTTcc:Sec Str : XXXXXXXXXXXXXX :SEG|132->145|ntqnqiihqqtifi : ###### :PROS|174->179|PS01302|UPF0758|PDOC01006| :============================================================:BL:SWS|1->226|RADC_STRZT|e-114|100.0|226/226 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|104->222|PF04002|2e-20|38.7|119/123|DUF2466 181: . * . . . .: 240 :VAPSQNDDHVTKLVKEACELMGIVLLDHLIVSHSNYFSYREKTDLI :Sequence :ccccHHHHHHHHHHHHHHHHHTcEEEEEEEEccccEEETTT :Sec Str :============================================== :BL:SWS|1->226|RADC_STRZT|e-114|100.0|226/226 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|104->222|PF04002|2e-20|38.7|119/123|DUF2466