[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55614.1 spne4 radC "DNA repair protein RadC"
MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTD
LKKMTLQELQSLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGD
KKQEHLVALYLNTQNQIIHQQTIFIGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGA
VAPSQNDDHVTKLVKEACELMGIVLLDHLIVSHSNYFSYREKTDLI
//