[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:scpB"

scpB        "segregation and condensation protein B"
SCPB_STRZT  "RecName: Full=Segregation and condensation protein B;"

OrgPattern -----------------------1-------------------------1----------------11 111-111111111111111-11111111111111111111111111--11111111-1--111-1111111----11111111----------------------11-1---------------111111111-1111111---11--------------------------------------11111111111111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-111111111-111111111-----11-11---1----11111111112------1--12--111-11-1111-1211111111111111111111111111111-----------------------------11111-111111111111111111111111111111111111111111111111111111111111-111111111111-1-----------111111111111111---------------------------1111-111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111------------------------11111111111111---1111111--------11-----1-1111111111111111111-1-1-1-111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETS:Sequence : HHHHHHHHccccccHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTccEEEEEET:Sec Str : =========================================================:RP:SCP|4->78|1t6sA1|2e-10|26.0|73/85|a.4.5.60 :============================================================:BL:SWS|1->189|SCPB_STRZT|e-102|100.0|189/189 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->164|PF04079|6e-32|50.0|156/160|DUF387 61: . . . * . .: 120 :GAYRLVTKPQFAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGA:Sequence :TEEEEEEcGGGHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccEEHHHHHHHHTcccccH:Sec Str :================== :RP:SCP|4->78|1t6sA1|2e-10|26.0|73/85|a.4.5.60 : ==================================:RP:SCP|87->157|1t6sA2|5e-08|40.8|71/77|a.4.5.60 :============================================================:BL:SWS|1->189|SCPB_STRZT|e-102|100.0|189/189 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->164|PF04079|6e-32|50.0|156/160|DUF387 121: . . + . . .: 180 :LAKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFG:Sequence :HHHHHHTTcEEEEEEcccTTccEEEEEcHHHHHHHcc :Sec Str :===================================== :RP:SCP|87->157|1t6sA2|5e-08|40.8|71/77|a.4.5.60 :============================================================:BL:SWS|1->189|SCPB_STRZT|e-102|100.0|189/189 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->164|PF04079|6e-32|50.0|156/160|DUF387 181: . * . . . .: 240 :ERIEEDENQ :Sequence : :Sec Str :========= :BL:SWS|1->189|SCPB_STRZT|e-102|100.0|189/189