[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56657.1 spne4 scpB "segregation and condensation protein B"
MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETS
GAYRLVTKPQFAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGA
LAKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFG
ERIEEDENQ
//