[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:sulB"

sulB        "dihydrofolate synthetase"
            ""

OrgPattern ------------------------21111111-----------------------------111---- 1111111111111111111-1-111-1111111111111111111111111111111211-11111111111111111111111111111111111---11111111111--------------111111111111111111111211112211111111111111211111111111111112212211121111111111111111111111111111121111111111111111111111111121111111211221212222112113211111112111222222222222222222222222222222222222111211111111111111111111111111111111111111111111212111111111111111111111122211111111111-211111111111211111111111111121111111111111111111111111111111111111111111111111111-11111111111111111111111111111111-1111111111111121111111111111111111111111111111-11111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111--1111--------111--1-1---1--------1-------1211111111121 11--111-311-2223322244334323353334333323332221543333433332232122222222222223313322222222-23232232222232223-2-12111-1211-11112-13-8D2-311-1-11113-1111111-1111122421211122113311111273122232262662121221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIGGTNGKGSTIAFLKKM:Sequence : HHTTccccccHTcHHHHHHHHHHHHHHHHccEEEEEEcccccccHHHHHHHH:Sec Str : ###################:PROS|42->65|PS01011|FOLYLPOLYGLU_SYNT_1|PDOC00773| :============================================================:RP:SCP|1->296|1o5zA2|4e-55|35.7|280/284|c.72.2.2 : ========================================:BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430 : $$$$$$$$$$$$$$$$$:RP:PFM|44->270|PF08245|2e-13|41.4|174/187|Mur_ligase_M 61: . . . * . .: 120 :LEKLGLRVGVFSSPYLIHYTDQISINGESISEARLEALMADYQSLLEGEAVANLQGTTEF:Sequence :TTTccEccccccEEccTTcccTTHHHHHHHTcTTcccHHHHHHHHHHHHHHHcTTcTccc:Sec Str :##### :PROS|42->65|PS01011|FOLYLPOLYGLU_SYNT_1|PDOC00773| :============================================================:RP:SCP|1->296|1o5zA2|4e-55|35.7|280/284|c.72.2.2 :============================================================:BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->270|PF08245|2e-13|41.4|174/187|Mur_ligase_M 121: . . + . . .: 180 :EIITALAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILTGITTIGLDHVALLGDTLEAI:Sequence :cHHHHHHHHHHHHccEEEEEccccTTHHHHHHHHHcccEEEEccccccccTTccccHHHH:Sec Str :============================================================:RP:SCP|1->296|1o5zA2|4e-55|35.7|280/284|c.72.2.2 :============================================================:BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->270|PF08245|2e-13|41.4|174/187|Mur_ligase_M 181: . * . . . .: 240 :AEQKAGIIKQGMPLVTGRIAPEALTVIDRIAEEKDAPRLAYGTDYQVRHQESVVTGEVFD:Sequence :HHHHGGGTTcTTcEEEEEccGGGGGGcTTcTTccccEEEEEcTTccccEEEEEEccccEE:Sec Str :============================================================:RP:SCP|1->296|1o5zA2|4e-55|35.7|280/284|c.72.2.2 :============================================================:BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->270|PF08245|2e-13|41.4|174/187|Mur_ligase_M 241: + . . . . *: 300 :YTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGRELASNDFLGQALEETSWPGRL:Sequence :EEETTcccEEEEccccHHHHHHHHHHHHHHHHTcccTTHTTccHHHHHHHGGGccccccc:Sec Str :======================================================== :RP:SCP|1->296|1o5zA2|4e-55|35.7|280/284|c.72.2.2 : ===:RP:SCP|298->437|1o5zA1|3e-12|27.6|134/137|c.59.1.2 :============================================================:BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|44->270|PF08245|2e-13|41.4|174/187|Mur_ligase_M 301: . . . . + .: 360 :EIVSRDPLMILDGAHNPHAIKALLVTLQERFADHHKEILFTCIKTKALEDMLDLLGAMPD:Sequence :cEETTTcEEEEEcccccHHHHHHHHHHTTcccccccEEEEEETHHHHHHHGGGccTTTcc:Sec Str :============================================================:RP:SCP|298->437|1o5zA1|3e-12|27.6|134/137|c.59.1.2 :============================================================:BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430 361: . . . * . .: 420 :TELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQNLTDKKEEKQTVRIVTGSLYF:Sequence :EEEEEEcTTHHHHHHHHHccTTcEEEEEccccccTHHHHHHHHHccTTEEEEEEEccccH:Sec Str :============================================================:RP:SCP|298->437|1o5zA1|3e-12|27.6|134/137|c.59.1.2 :============================================================:BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430 421: . . + . . .: 480 :LSQVRAYLMERKNENGYTKD :Sequence :HHHHHHHHHHHHHH :Sec Str :================= :RP:SCP|298->437|1o5zA1|3e-12|27.6|134/137|c.59.1.2 :======== :BL:SWS|21->428|FOLC_BACSU|3e-67|36.2|403/430