[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:yajC"

yajC        "preprotein translocase, YajC subunit"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1--1---11-----------------------------------------------------------111111111111111------111-------1--------111111111111111----1-1-11-1---11111111111111111111111111111111111111111111111111--111---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDT:Sequence : ======================================================:BL:SWS|7->85|Y1229_BACHD|8e-09|37.2|78/88 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->85|PF02699|1e-07|40.0|80/82|YajC 61: . . . * . .: 120 :EKGTIVLDVDGVYLTFELAAIKTVLPLKETASLEGAIEK :Sequence :========================= :BL:SWS|7->85|Y1229_BACHD|8e-09|37.2|78/88 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->85|PF02699|1e-07|40.0|80/82|YajC