[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF54887.1 spne4 yajC "preprotein translocase, YajC subunit"
MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDT
EKGTIVLDVDGVYLTFELAAIKTVLPLKETASLEGAIEK
//