[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54134.1"

            "Phenazine biosynthesis PhzC/PhzF protein"
            ""

OrgPattern -------------------------1111111-----------1------1---------1------- --1-1---111-------------------------1-11--1-------------1---11----11111----------1-------------------1--11111-------------------------1---------1----111-1111----11111-111-----------------------111111112-1-111--1--1-11--1-----1111--11--------------------1------------------------1-1-------------------------------------------12-1111-112----211------1-------11-----1----11--1--21111---------1----------------------1-----1-1-------------1-11211--------11111111-----111------------------------------1111-------11-1-1--------------21---11--111-----111-1---1----1--------------------------------------1111-------1-----------------------11-1112--1-131--1------------1-------------11---111111111111-1111111111111--1--212111--21-111111111111111--1---11-1--------------2-----3222-12-1---------------2222221111--2242121-111111-------------1---11--122111-111-11----------2----11------------------------------------11-11------11 ------1-11--111-----------------------------------------------------------------1---------------111-1------14242-1-411111-1121121462-22111-11111-1111-111-1112-11-1-21-----441---111-1-113211-32-112211 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYE:Sequence :cEEEEEEEEccccETTcEEEEEEcccTTccHHHHHHHHHHHccccEEEEEccccTccccc:Sec Str : =========================================================:RP:SCP|4->265|1s7jA|5e-69|42.6|251/260|d.21.1.2 : ======================================================:BL:SWS|7->265|Y2770_PSEAE|3e-57|52.4|248/259 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->262|PF02567|1e-43|50.0|256/274|PhzC-PhzF 61: . . . * . .: 120 :LRWFTPTTEVDLCGHATLAAAHVLAAGGAEGPFRFASRSGVLTVTARDGLLWLDFPANPP:Sequence :EEEEEccccEcccHHHHHHHHHHHHHTTccccEEEEETTEEEEEEEEEcTTccEEEEEcc:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|74->91|ghatlaaahvlaaggaeg :============================================================:RP:SCP|4->265|1s7jA|5e-69|42.6|251/260|d.21.1.2 :============================================================:BL:SWS|7->265|Y2770_PSEAE|3e-57|52.4|248/259 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->262|PF02567|1e-43|50.0|256/274|PhzC-PhzF 121: . . + . . .: 180 :YAKDVPDGLVAALGGEPVWAGFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTA:Sequence :EccccHHHHHHHTTccGGGccTTcccEEEEEEcccHHHHHHcccGGGHHHHcTcEEEEEE:Sec Str :============================================================:RP:SCP|4->265|1s7jA|5e-69|42.6|251/260|d.21.1.2 :============================================================:BL:SWS|7->265|Y2770_PSEAE|3e-57|52.4|248/259 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->262|PF02567|1e-43|50.0|256/274|PhzC-PhzF 181: . * . . . .: 240 :PADPGQPYDFVSRLFAPAIGIPEDPVTGSAHTALGPYWAQRLGRTRLDAVQCSARGGRLV:Sequence :cccccTTccEEcEEccTTccccEEcccHHHHHHHHHHTccccccEEEEEEEcGTccEEEE:Sec Str :============================================================:RP:SCP|4->265|1s7jA|5e-69|42.6|251/260|d.21.1.2 :============================================================:BL:SWS|7->265|Y2770_PSEAE|3e-57|52.4|248/259 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->262|PF02567|1e-43|50.0|256/274|PhzC-PhzF 241: + . . . . *: 300 :VELPADAPDRVLIGGTAVTVSEGTLRY :Sequence :EEEEccTTcEEEEEEcEEEEEEEEEE :Sec Str :========================= :RP:SCP|4->265|1s7jA|5e-69|42.6|251/260|d.21.1.2 :========================= :BL:SWS|7->265|Y2770_PSEAE|3e-57|52.4|248/259 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->262|PF02567|1e-43|50.0|256/274|PhzC-PhzF