[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54134.1 tfus0 AAZ54134.1 "Phenazine biosynthesis PhzC/PhzF protein"
MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYE
LRWFTPTTEVDLCGHATLAAAHVLAAGGAEGPFRFASRSGVLTVTARDGLLWLDFPANPP
YAKDVPDGLVAALGGEPVWAGFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTA
PADPGQPYDFVSRLFAPAIGIPEDPVTGSAHTALGPYWAQRLGRTRLDAVQCSARGGRLV
VELPADAPDRVLIGGTAVTVSEGTLRY
//