[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54138.1"

            "RNA binding S1:Resolvase, RNase H-like fold"
            ""

OrgPattern --------------------------------11----11111------------------------- 1-1-11111111111------1--11-----111111111-111--------111-----11--1111111---------1-------2111-1-----1111--111-1--------------1---------1---------11111111--------------1111----------------------11111111111111111111111111111111111111111111111111111111111111-1-11-1---11111111111-1111111111111111111111111111111111111111111---1-1111111111111111111111111111111-1111--11--11---111-2---------111111--11111--11--1-111-1111111111--1111111111111111---11111-11-------------11------------------------------------111111111111111111111111111111111-1111111111111111111---1111111111111111111-111-11111-111111111----11-11-------------------1---1--111111111111111111111111111111--1111-------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111111111111111111111121111111111111111111111111----------1111111111111111111111111111--1---------------111------11--1----------1111-1111------1- --------211---111111111111111111111111111111111111111111111111-1------1-1-----------1-1---111--------1-111-12-32323112211222422412B212132211212221221221121223212113262312B4131---19111--1---1--1-1---1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIEERLR:Sequence : HHHHHHHHHHHTcTTcccHHHHHHHHTccHHHHHHHcHHHHTcccHHHHHHHHHHHH:Sec Str : XXXXX:SEG|56->69|eerlrylreleerr : =========================================================:RP:SCP|4->321|2oceA3|4e-99|52.8|316/323|a.294.1.1 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->201|PF09371|2e-52|64.2|193/193|Tex_N 61: . . . * . .: 120 :YLRELEERRTVILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREA:Sequence :HHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHcccHHHHHHHHGGGccccccHHHHHHHT:Sec Str :XXXXXXXXX :SEG|56->69|eerlrylreleerr :============================================================:RP:SCP|4->321|2oceA3|4e-99|52.8|316/323|a.294.1.1 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->201|PF09371|2e-52|64.2|193/193|Tex_N 121: . . + . . .: 180 :GLEPLADALLNDPSRDPHDQAAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELR:Sequence :TTHHHHHHHHHcTTccHHHHHHTTccGGGTcccHHHHHHHHHHHHHHHHHTcHHHHHHHH:Sec Str :============================================================:RP:SCP|4->321|2oceA3|4e-99|52.8|316/323|a.294.1.1 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->201|PF09371|2e-52|64.2|193/193|Tex_N 181: . * . . . .: 240 :ERMWQRGRLVSRVREGKEEVGVKFADYFDFAEAFTTLPSHRVLALFRGEKEEVLDLTLEP:Sequence :HHHHHHcEEEEEEcTTcTTTTGGGGGGTEEEEEGGGccHHHHHHHHHHHHTTcEEEEEEc:Sec Str : XX:SEG|239->250|epeepaedprar :============================================================:RP:SCP|4->321|2oceA3|4e-99|52.8|316/323|a.294.1.1 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->201|PF09371|2e-52|64.2|193/193|Tex_N 241: + . . . . *: 300 :EEPAEDPRARSSYEVRIAQHFGIADQGRPGDRWLLDTVRWAWRTRILVRLDIDLRSRLWQ:Sequence :cccccccHcccHHHHHHHHHTTccccccTTHHHHHHHHHHHHHHTHHHHHHHHHHHHHHH:Sec Str :XXXXXXXXXX :SEG|239->250|epeepaedprar :============================================================:RP:SCP|4->321|2oceA3|4e-99|52.8|316/323|a.294.1.1 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 301: . . . . + .: 360 :EAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVKVAVVDGTGKVVDTATIYPHE:Sequence :HHHHHHHHHHHHHHHHHHTccccccccEEEEEcccTTcEEEEEEcTTccEEEEEEEcccT:Sec Str :===================== :RP:SCP|4->321|2oceA3|4e-99|52.8|316/323|a.294.1.1 : =======================================:RP:SCP|322->470|2oceA5|3e-34|69.1|149/149|c.55.3.13 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 361: . . . * . .: 420 :PQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLAADLIKRHPELKLTKVMVSEAG:Sequence :TTccHHHHHHHHHHHHHHTTccEEEEEccTTHHHHHHHHHHHHHHcGGGccEEEEEccTT:Sec Str : XXXXX:SEG|416->431|vseagasvysasayas :============================================================:RP:SCP|322->470|2oceA5|3e-34|69.1|149/149|c.55.3.13 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 421: . . + . . .: 480 :ASVYSASAYASQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSEVKL:Sequence :HHHHHTcHHHHHHcTTccHHHHHHHHHHHHHHcHHHHHTTccGGGccccTTTTTccHHHH:Sec Str :XXXXXXXXXXX :SEG|416->431|vseagasvysasayas :================================================== :RP:SCP|322->470|2oceA5|3e-34|69.1|149/149|c.55.3.13 : ==========:RP:SCP|471->560|2oceA1|5e-21|73.3|90/90|a.60.2.6 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 481: . * . . . .: 540 :SRSLDAVVEDCVNAVGVDVNTASVPLLSRVSGITASLAQNIVAYRDANGPFRTRAQLREV:Sequence :HHHHHHHHHHHHHHHcEETTTccHHHHTTcTTccHHHHHHHHHHHHHHccccccGGGGGc:Sec Str :============================================================:RP:SCP|471->560|2oceA1|5e-21|73.3|90/90|a.60.2.6 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 541: + . . . . *: 600 :PRLGPKAFEQCAGFLRIPDGDDPLDSSSVHPEAYPVVRRILEATGRDIRALIGDTDTLRS:Sequence :TTccHHHHHHHHTTEEcTTcccGGGGccccGGGHHHHHHHHHHTTccHHHHTTcHHHHHH:Sec Str :==================== :RP:SCP|471->560|2oceA1|5e-21|73.3|90/90|a.60.2.6 : ========================================:RP:SCP|561->633|2oceA2|1e-27|68.5|73/73|a.60.2.6 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 601: . . . . + .: 660 :LRPDDFVDERFGLPTVTDILAELEKPGRDPRPEFQTAAFRDGVEDITDLEPGMVLEGVVT:Sequence :ccGGGTccccccHHHHHHHHHHHHcTTccccccccHHHHHHTcccGGGccTTcEEEEEEE:Sec Str :================================= :RP:SCP|561->633|2oceA2|1e-27|68.5|73/73|a.60.2.6 : ======================================:RP:SCP|623->701|1jjgA|1e-08|7.6|79/102|b.40.4.5 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 661: . . . * . .: 720 :NVAAFGAFVDVGVHHDGLVHVSAMSKSFVKDPRDVVKPGDIVRVKVLDVDVRRKRISLTL:Sequence :EEETTEEEEEccccccEEEEGGGGcccccccHHHHccTTcEEEEEEEEEETTTTEEEEEc:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|662->681|vaafgafvdvgvhhdglvhv : XXXXXXXXXXXXXX :SEG|702->715|vrvkvldvdvrrkr :========================================= :RP:SCP|623->701|1jjgA|1e-08|7.6|79/102|b.40.4.5 :============================================================:BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773 721: . . + . . .: 780 :RLDDEVDQRSGENNRSGGERRERGAPRRGDQRRQRGGRGEQQPMGAMAEALRRAGLV :Sequence :cTTcc :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|729->763|rsgennrsggerrergaprrgdqrrqrggrgeqqp :===== :BL:SWS|1->725|YHGF_ECOLI|0.0|59.5|723/773