[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54145.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----111111111111111-111111111111111111221111111111111111111111111111111-------------------------2---------------------------------------------------------------------------------------------------------------------1----11----------1----------------------------------------------------------------------------------------------------------------------------11-----------------1----------1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-1-1-----1----1--------------------------------1----------------------------1----------------1---1-------11----------111111-------------------------11----1---------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVNTTGRVLRRIGTAAAVTGALGVAGLVYASVVERNWFRLRHYEIPILAPGSDRLRILHL:Sequence : cccGGGcccccccccccEEEEE:Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|13->33|gtaaavtgalgvaglvyasvv : ======:RP:SCP|55->290|1t70A|1e-12|14.9|221/255|d.159.1.9 : ==============:BL:SWS|47->302|YKUE_BACSU|6e-15|33.5|224/286 61: . . . * . .: 120 :SDAHLTPGRRLLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGPLLDRPGLFVYG:Sequence :cccccccccTTTccHHHHHHHccccEEEEEccHccccccHHHHHHHHHHHTTccccEEEE:Sec Str :============================================================:RP:SCP|55->290|1t70A|1e-12|14.9|221/255|d.159.1.9 :============================================================:BL:SWS|47->302|YKUE_BACSU|6e-15|33.5|224/286 121: . . + . . .: 180 :SNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWRELGAAMREAGWLDLNNQKGHLTAGN:Sequence :ccTTccHHHHHHHHGGGcGGGcccGGcEGcEEEEcccccEEEEEccccTTcccccccHHH:Sec Str :============================================================:RP:SCP|55->290|1t70A|1e-12|14.9|221/255|d.159.1.9 :============================================================:BL:SWS|47->302|YKUE_BACSU|6e-15|33.5|224/286 181: . * . . . .: 240 :LRIAAAGIHDSHIGLDRYEKIAGPADPTADVRIGVMHSPEPRNLDRFTADGYELLLAGHT:Sequence :HHHHHHHHHHHTTccEEEEcccccccccTTTGGGccTTTHHHHHHHHHcTTEEEEEEccc:Sec Str :============================================================:RP:SCP|55->290|1t70A|1e-12|14.9|221/255|d.159.1.9 :============================================================:BL:SWS|47->302|YKUE_BACSU|6e-15|33.5|224/286 241: + . . . . *: 300 :HGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGGLGTSPYAPVRFCCRPEAALL:Sequence :cccEEEEETTEEEEEcccccccccccccccEEEEEEEETTEEEEEEEEcccccccccccH:Sec Str :================================================== :RP:SCP|55->290|1t70A|1e-12|14.9|221/255|d.159.1.9 :============================================================:BL:SWS|47->302|YKUE_BACSU|6e-15|33.5|224/286 301: . . . . + .: 360 :DLIPRA :Sequence :HHHcc :Sec Str :== :BL:SWS|47->302|YKUE_BACSU|6e-15|33.5|224/286