[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54145.1 tfus0 AAZ54145.1 "conserved hypothetical protein"
MVNTTGRVLRRIGTAAAVTGALGVAGLVYASVVERNWFRLRHYEIPILAPGSDRLRILHL
SDAHLTPGRRLLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGPLLDRPGLFVYG
SNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWRELGAAMREAGWLDLNNQKGHLTAGN
LRIAAAGIHDSHIGLDRYEKIAGPADPTADVRIGVMHSPEPRNLDRFTADGYELLLAGHT
HGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGGLGTSPYAPVRFCCRPEAALL
DLIPRA
//