[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54149.1"

            "putative ion-transporting ATPase"
            ""

OrgPattern -------------------------------------111--------------------1------- ---21---------11111-111111111111111111111111----------------111-1111111-------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------111121---------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNPTPPRTLDVDDLLDNPGTRIVVCCGSGGVGKTTTAAALALRAAERGRHTVVITVDPAR:Sequence : HHHHHHTTccccEEEEEEEccccTTcccHHHHHHHHHHHHHHTTccEEEEEccccc:Sec Str : XXXXXXXXXXXX :SEG|34->45|tttaaalalraa : ==============================================:RP:SCP|15->288|1f48A1|9e-24|23.2|228/296|c.37.1.10 : ==========================================:BL:SWS|19->177|ARSA_METJA|3e-10|28.4|148/349 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->288|PF02374|5e-28|40.3|233/248|ArsA_ATPase 61: . . . * . .: 120 :RLAQSLGLTELDNTPRPVPGVADSNGGSLHAMMLDMKRTFDETVEAHADPQRAEQILNNP:Sequence :THHHHTTHHTccccccHHHccccEETTEEEEcHHHHHTTTTcHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|15->288|1f48A1|9e-24|23.2|228/296|c.37.1.10 :============================================================:BL:SWS|19->177|ARSA_METJA|3e-10|28.4|148/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->288|PF02374|5e-28|40.3|233/248|ArsA_ATPase 121: . . + . . .: 180 :FYQSLSSSFAGTQEYMAMEKLGQLRRSDEWDLIVVDTPPSRSALDFLDAPKRLGRFLDGR:Sequence :HTTcTTcccGccGGccccEEEccccHHGGGccEEEccccTTccccEEEccccHHHHHTTc:Sec Str :============================================================:RP:SCP|15->288|1f48A1|9e-24|23.2|228/296|c.37.1.10 :========================================================= :BL:SWS|19->177|ARSA_METJA|3e-10|28.4|148/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->288|PF02374|5e-28|40.3|233/248|ArsA_ATPase 181: . * . . . .: 240 :LVRFLGTPARGGAFRLLGAGFGLVTGVITKILGTQLLKDVQSFIGAFDAVFGGFQERAEQ:Sequence :ccHHHHcEEETTTTEEEEccccccccHHHHHTcHHHHHHHHHHHHHccEEEEEcccTTTc:Sec Str : XXXXXXXXXXXXXXX :SEG|189->203|arggafrllgagfgl :============================================================:RP:SCP|15->288|1f48A1|9e-24|23.2|228/296|c.37.1.10 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->288|PF02374|5e-28|40.3|233/248|ArsA_ATPase 241: + . . . . *: 300 :TYRILQTEGTAFLVVAAPELDALREASYFVARLSAEQMPLAGLVLNRVQQVHADLSAEQG:Sequence :HHHHHGGGccEEEEEEETTTccTTHHHHHHHHHHHTTcccccEEEEEc :Sec Str :================================================ :RP:SCP|15->288|1f48A1|9e-24|23.2|228/296|c.37.1.10 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|21->288|PF02374|5e-28|40.3|233/248|ArsA_ATPase 301: . . . . + .: 360 :SAAAELLEATGEHPLAAAALRLHAGRVRQRNREQRLRNRFAADHPDVAIAEVPAYPEDVH:Sequence : :Sec Str : XXXXXXXXXX :SEG|315->324|laaaalrlha : XXXXXXXXXXXXXX :SEG|326->339|rvrqrnreqrlrnr 361: . . . * . .: 420 :DLDALRAIGRALAGVSTVP :Sequence : :Sec Str