[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54205.1"

            "conserved hypothetical protein"
            ""

OrgPattern -----------------------------------------------1-------------------- ------------------------1-11111---------------------------------------1---------1--------------------11--1-11-----------------------1------------------------------------1----1------------------1-------------1---------1------1------1----------------------------------------------------------------------------------------------------1-------------------------1------------------11-----------------------------------------1------1-1-1--------------1-----------------1-------------------------------------1--111--1---------------1-----1--11---1------------------------1-1-1-----1----1111--1------------1--------------------------------------1-------1--1----1---1--------------1---------------------------------------11----------------------------------------------------------1-------------------------------1-------11-----------------------------------------------11------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRTAGGGISYPQPGTTALDRLREGELTVRVAMHQPHYLPWLGLLDKIDRCDLFVVLDHVQ:Sequence : ================================:BL:SWS|29->259|Y1507_MYCTU|4e-26|30.4|227/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->252|PF08889|6e-55|45.1|215/219|WbqC 61: . . . * . .: 120 :FERKGWQHRNYVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSPWWEKHSRTLAQHCYRK:Sequence :============================================================:BL:SWS|29->259|Y1507_MYCTU|4e-26|30.4|227/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->252|PF08889|6e-55|45.1|215/219|WbqC 121: . . + . . .: 180 :APFWDEFGAEITAIYERRWEQLVDLSLATTEFVLNAFGITTPMVRSSELGEFTVQKSELL:Sequence :============================================================:BL:SWS|29->259|Y1507_MYCTU|4e-26|30.4|227/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->252|PF08889|6e-55|45.1|215/219|WbqC 181: . * . . . .: 240 :AQISAKVGATTMLSGDGARAYLDKDVFDRYGIAVEWQNFQHPEYPQHNRKGQEFLPRMAA:Sequence :============================================================:BL:SWS|29->259|Y1507_MYCTU|4e-26|30.4|227/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->252|PF08889|6e-55|45.1|215/219|WbqC 241: + . . . . *: 300 :IDLLLNVGPEGMDLVRQARIAD :Sequence :=================== :BL:SWS|29->259|Y1507_MYCTU|4e-26|30.4|227/100 :$$$$$$$$$$$$ :RP:PFM|34->252|PF08889|6e-55|45.1|215/219|WbqC