[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54205.1 tfus0 AAZ54205.1 "conserved hypothetical protein"
MRTAGGGISYPQPGTTALDRLREGELTVRVAMHQPHYLPWLGLLDKIDRCDLFVVLDHVQ
FERKGWQHRNYVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSPWWEKHSRTLAQHCYRK
APFWDEFGAEITAIYERRWEQLVDLSLATTEFVLNAFGITTPMVRSSELGEFTVQKSELL
AQISAKVGATTMLSGDGARAYLDKDVFDRYGIAVEWQNFQHPEYPQHNRKGQEFLPRMAA
IDLLLNVGPEGMDLVRQARIAD
//