[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54369.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTFTARGLYASSSKEPRGRRGRWWLVIGAIVGLAALGTGVLGILTTAVSETTTDTTEFPA:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|25->56|lvigaivglaalgtgvlgilttavsetttdtt 61: . . . * . .: 120 :PSRLEIDNNTEGSVTLVAEDTDTVTVRVDVWSSMMSQPSWDTETEGDTLRLAANCSLIFT:Sequence : XXXXXXXXXXX :SEG|80->90|dtdtvtvrvdv 121: . . + . . .: 180 :VFGRCSVDYEVAVPEGTEVSVHTVTGDVDVTGVSARVDASTDTGEIRLADVTGEITAESA:Sequence : XXXXXXXXXXXXXXXX :SEG|139->154|vsvhtvtgdvdvtgvs 181: . * . . . .: 240 :TGRITAAGSGPSAVVTSDTGEINLEDFQAADVQATSAIGAIRIGSGFDTARVRSDTGAIT:Sequence 241: + . . . . *: 300 :VTTDTEFQTLHATTAIGNIELQVPDRVYRVTADTTVGSPKVAVDQSRDATSVIEARSDTG:Sequence 301: . . . . + .: 360 :DITITPR :Sequence