[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54369.1 tfus0 AAZ54369.1 "hypothetical protein"
MTFTARGLYASSSKEPRGRRGRWWLVIGAIVGLAALGTGVLGILTTAVSETTTDTTEFPA
PSRLEIDNNTEGSVTLVAEDTDTVTVRVDVWSSMMSQPSWDTETEGDTLRLAANCSLIFT
VFGRCSVDYEVAVPEGTEVSVHTVTGDVDVTGVSARVDASTDTGEIRLADVTGEITAESA
TGRITAAGSGPSAVVTSDTGEINLEDFQAADVQATSAIGAIRIGSGFDTARVRSDTGAIT
VTTDTEFQTLHATTAIGNIELQVPDRVYRVTADTTVGSPKVAVDQSRDATSVIEARSDTG
DITITPR
//