[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54436.1"

            "TatD-related deoxyribonuclease"
            ""

OrgPattern ---------------12-1-1-----------22111-----------11111111-1-11---11-- 1111111111111111111-121111111111111111111111111111111111111111111111111111111111-1111111111-11111--1121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121112222222111112222111112222222212111111221111212221122221122221111212211111211111111222222212112121111111111111111111111111111223323222333222222323222222312221-11-1211111133323323333333333-33333333333333333333233322233333333333333332332333311222232223233111311111111112323222221111212112222222211121223211112121222231111111111333333333333332112222222111111211111111111111122111112-112-1111111111211111111111111111 ----221-------1----------------------------------------------------------------------------1---------------111--21-----1----1-1---2---11-1---1212--1-1---2----3----111----21221-1-1511--------1---2121- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLSVSKSRRQREKRDRARTEPPPLPEPLRVAVPDCHTHMDMQGGDVAEIVAKAASVGVTP:Sequence : EEEEcTTccccHHHHHHHHHHHHTTcc:Sec Str : XXXXXXXXXXXXXXXXX :SEG|17->33|arteppplpeplrvavp : ===========================:RP:SCP|34->303|1j6oA|6e-48|28.9|246/260|c.1.9.12 : ===========================:BL:SWS|34->305|YABD_BACSU|1e-34|36.8|247/255 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->303|PF01026|2e-38|37.3|249/255|TatD_DNase 61: . . . * . .: 120 :IIQVGCDVAGSRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPEDEATEWEPARPAGGEA:Sequence :TTcHHHHHHHHHHHHHHHHHcTTTEEEEEcccTTccGGccHHHHHHHHHHHHHHHTTTTH:Sec Str : XXXXXXXXXXXX:SEG|109->136|eweparpaggeaaleealaeidalaahe :============================================================:RP:SCP|34->303|1j6oA|6e-48|28.9|246/260|c.1.9.12 :============================================================:BL:SWS|34->305|YABD_BACSU|1e-34|36.8|247/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->303|PF01026|2e-38|37.3|249/255|TatD_DNase 121: . . + . . .: 180 :ALEEALAEIDALAAHEKVCAIGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIH:Sequence :HHHHHHHHHHHccTTcTccEEEEEcccTTcTTTccHHHGGGGHHHHHHHHHTTcccEEEc:Sec Str :XXXXXXXXXXXXXXXX :SEG|109->136|eweparpaggeaaleealaeidalaahe :============================================================:RP:SCP|34->303|1j6oA|6e-48|28.9|246/260|c.1.9.12 :============================================================:BL:SWS|34->305|YABD_BACSU|1e-34|36.8|247/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->303|PF01026|2e-38|37.3|249/255|TatD_DNase 181: . * . . . .: 240 :DRDAHEDVLRVLEDAGAPERVVFHCFSGDAAMAKLCADRGYYMSFAGNVTFGSAQQLRDA:Sequence :ccTTccHHHHHHHHcTTccEEEGGGGGGGHHHHHHHHHHcTTEEEEcTTccGccHHHHHH:Sec Str : X:SEG|240->252|aaavvplelllve : #:PROS|240->256|PS01091|TATD_3|PDOC00836| :============================================================:RP:SCP|34->303|1j6oA|6e-48|28.9|246/260|c.1.9.12 :============================================================:BL:SWS|34->305|YABD_BACSU|1e-34|36.8|247/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->303|PF01026|2e-38|37.3|249/255|TatD_DNase 241: + . . . . *: 300 :AAVVPLELLLVETDAPFLTPKPHRGRPNAPYLIPHTLRALAELKGMAEDELAETVAANAR:Sequence :HHHHcTTTEEccccTTcccHcTTcTTHccGGGHHHHHHHHHHHHcccHHHHHHHHTHHHH:Sec Str :XXXXXXXXXXXX :SEG|240->252|aaavvplelllve :################ :PROS|240->256|PS01091|TATD_3|PDOC00836| :============================================================:RP:SCP|34->303|1j6oA|6e-48|28.9|246/260|c.1.9.12 :============================================================:BL:SWS|34->305|YABD_BACSU|1e-34|36.8|247/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->303|PF01026|2e-38|37.3|249/255|TatD_DNase 301: . . . . + .: 360 :RAFALP :Sequence :HHHTcT :Sec Str :=== :RP:SCP|34->303|1j6oA|6e-48|28.9|246/260|c.1.9.12 :===== :BL:SWS|34->305|YABD_BACSU|1e-34|36.8|247/255 :$$$ :RP:PFM|34->303|PF01026|2e-38|37.3|249/255|TatD_DNase