[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54441.1"

            "hypothetical protein"
            ""

OrgPattern --------------------------------------------------121--------------- -1--6-------------------------------2----959----------------1----1-4872-------------------------1---------------------------12-1-----2321-------A-5-2-221-------------4-333------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1----------------11-----------11------------------------------------------------------------------------------12-------------------------12-1-----------------------------------2------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------------------------------------- ------4--------1-21947286AB112111662-111123---752J9357234C1314---------------------------------*-----------18-K---------------------------------------------------------------O-12-----------9--31----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTSRRSHETPQGPDPRSPGAAPAYREAPPALTGRELADAVYLAAWQQHTAQHPPARPSGG:Sequence : :Sec Str 61: . . . * . .: 120 :KDTALYAPSRVRGALLARPSQQRHDPKRRRHRVRGALLARPSGGKDTAPAAGPQRPGTDP:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|83->94|rhdpkrrrhrvr 121: . . + . . .: 180 :SAAVLGAAEKTAGTEPPRLPPAPAPPSGALRPHPSPLLHRSALYQALRPFRLAATDPWQH:Sequence : :Sec Str : XXXXXXXXXXXXXXXXX :SEG|136->152|pprlppapappsgalrp 181: . * . . . .: 240 :SYDAEETARGYARRLLASPHPGGGHRPVAVTPQWAPFVRPGVQLTVLVDESVSMLFHQDQ:Sequence : :Sec Str 241: + . . . . *: 300 :VNDFIGLVRSSGVFRGVRVERFTSDSADPAPVPAAGWGASSGKDPGGIHIAVVLSDGIGE:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|248->262|vrssgvfrgvrverf : XXXXXXXXXXXX :SEG|264->275|sdsadpapvpaa 301: . . . . + .: 360 :GWARGSVQSWLGCLAQRLPVAIIHLLDPRQWSRTGIRPAAMELTVAAHLGRAPANRHYTA:Sequence : :Sec Str 361: . . . * . .: 420 :RPFQWPDGLPLPEPEFPHSALSVVLPVLASRPEMIHAWARFVMGTRQRTLNAGALRVVPG:Sequence : :Sec Str 421: . . + . . .: 480 :DTAANAAGERPTAAPTPEARVRRFRRDSSETAFQIAVDLAAVPLTEPVIAAVCQRFAGHP:Sequence : :Sec Str 481: . * . . . .: 540 :QPSELIEVLFSGLVTEVDSPVVTPERRIRWEYRRGVREALLSLGGRRSRIRRTLADIAAE:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|517->535|reallslggrrsrirrtla 541: + . . . . *: 600 :FAGYDPWFALLRRILDDSPVGELPELDETSLRLAADTLPALESIGLADLHHGLVYRIKEQ:Sequence : :Sec Str 601: . . . . + .: 660 :MLAHQGAGHPDDWSDTLLEIAPTGPLVPGSSGQHGTTASERVPHAPHPTETPSNSASDES:Sequence : :Sec Str : XXXXXXXX:SEG|653->671|snsasdessmmsqrsvsis 661: . . . * . .: 720 :SMMSQRSVSISDNFPGGSGSTGIGAGRNTSLSAIWGGDIPPRNALFTGRDDLILRLREQL:Sequence : ccccccccccHHHHHHHHHHH:Sec Str :XXXXXXXXXXX :SEG|653->671|snsasdessmmsqrsvsis : XXXXXXXXXXX :SEG|676->686|ggsgstgigag : ========================:RP:SCP|697->873|2a5yB3|7e-10|22.3|166/275|c.37.1.20 : =============:BL:SWS|708->842|DRL37_ARATH|5e-06|31.8|129/843 721: . . + . . .: 780 :RSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRFRDEYDLVWWVRGGQTHQIHEAYTLLAQ:Sequence :HHTTccccEEEEEE EcTTccHHHHHHHHHHccTcTTTccEEEEEEccccccTHHHHHHH:Sec Str :============================================================:RP:SCP|697->873|2a5yB3|7e-10|22.3|166/275|c.37.1.20 :============================================================:BL:SWS|708->842|DRL37_ARATH|5e-06|31.8|129/843 781: . * . . . .: 840 :ELDVFRDNTSINSTIHSVREALRRGKPRSRWLLIFDDVRQPDDIMRYLPIAGPGHVIITT:Sequence :HHHccHHHHHHccccccccHHHHHHHHHHHTTccccEEEccccHHHHHHHHHTTcEEEEE:Sec Str :============================================================:RP:SCP|697->873|2a5yB3|7e-10|22.3|166/275|c.37.1.20 :============================================================:BL:SWS|708->842|DRL37_ARATH|5e-06|31.8|129/843 841: + . . . . *: 900 :RNLTWPEGGYFKTLPVEVFSLQESVALLSKCGLVGFSKHEAAELAEELGHMPIALRQAAA:Sequence :GGGGTTcccccEEEEEccccHHHHHHHHHHTTccHHHHHHHHHHHHHTTTcHHHHHHHHH:Sec Str : XXXXXXXXX :SEG|880->888|eaaelaeel :================================= :RP:SCP|697->873|2a5yB3|7e-10|22.3|166/275|c.37.1.20 :== :BL:SWS|708->842|DRL37_ARATH|5e-06|31.8|129/843 901: . . . . + .: 960 :WMNDSATTIAEYLEFYRDKQAQLAPMFAPADPDYPETVITALNVSLDRLAVTNPAALQLL:Sequence :Hccc ccHHHHHHHHHHHHHHcGGGGccccccccccHHHHHHHHHTcc cTTHHHHT:Sec Str 961: . . . * . .:1020 :QVCSFFSTAPIPRSLFRHAQDVAAPPELEAALQEPNKLHRAFSDIGRYGLAVLNHRTRTV:Sequence :TTTTcc cTTcEEEHHHHHTTcccTTTcTTTHHHHcccccEEEc ccccEE:Sec Str : XXXXXXXXXX :SEG|983->992|aappeleaal 1021: . . + . . .:1080 :QVHRLVQQALRVPLTADDQEQRRHCAHLLLAKNDPQDTSSPGARIRYAQLLPHVWATEAW:Sequence :EccHHHHHHHHTTccTTHHHHHHHTTcc HHHHHH:Sec Str 1081: . * . . . .:1140 :DCTDSWVRRLVLQEIYVTDLRGEHSDSKQLAEATLSVWREKLGKTAPETLRAELYLVRAL:Sequence :HHHHHHHT TccHH ccccccTTccHHHHHHHHHHHHHHTccccccccHHHHHTTTc:Sec Str : ==================:BL:SWS|1123->1224|TIF31_NEUCR|5e-05|28.4|102/1211 1141: + . . . . *:1200 :RNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFVRDLRYAGRFHDSVELARDTRD:Sequence :cccccTTTHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1123->1224|TIF31_NEUCR|5e-05|28.4|102/1211 1201: . . . . + .:1260 :RYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVD:Sequence :HHHHHHcTTcHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHcTTcHHHHHHHH:Sec Str : =================:RP:SCP|1244->1420|1ddbA|3e-13|8.8|171/195|f.1.4.1 :======================== :BL:SWS|1123->1224|TIF31_NEUCR|5e-05|28.4|102/1211 : ======================================================:BL:SWS|1207->1411|NPHP3_MOUSE|2e-09|22.0|205/1324 1261: . . . * . .:1320 :GYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKI:Sequence :HHHHHHHTTTcHHHHHHHHHHHHHHHHHHccTTcHHHHHHHHHHHHHHHHHTcHHHHHHH:Sec Str :============================================================:RP:SCP|1244->1420|1ddbA|3e-13|8.8|171/195|f.1.4.1 :============================================================:BL:SWS|1207->1411|NPHP3_MOUSE|2e-09|22.0|205/1324 1321: . . + . . .:1380 :SGEVWRETKDRFGEDSMIAVVAAANHAAALRSVNRYHEALDLVEKAYRRCAELLGEDHPH:Sequence :HHHHHHHHHHHHcccccccccHHHHHHHHHHTTcccccccccHHccTTHHHHTTccccHH:Sec Str : XXXXXXXXXXX :SEG|1339->1349|avvaaanhaaa :============================================================:RP:SCP|1244->1420|1ddbA|3e-13|8.8|171/195|f.1.4.1 :============================================================:BL:SWS|1207->1411|NPHP3_MOUSE|2e-09|22.0|205/1324 1381: . * . . . .:1440 :VAAINVNRAVVLRQMGRTEEARVIDERALQVLTDRLGEYHTSTLSSALNLASDFFGLDDV:Sequence :HHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTcccH:Sec Str : XXXXXXXXXXXX :SEG|1421->1432|tstlssalnlas :======================================== :RP:SCP|1244->1420|1ddbA|3e-13|8.8|171/195|f.1.4.1 :=============================== :BL:SWS|1207->1411|NPHP3_MOUSE|2e-09|22.0|205/1324 1441: + . . . . *:1500 :AESVRRDTETLARCRRALSERHPLTLLARRNLVLGRKAMNEDVAEEIAAVERLYAEVMGD:Sequence :HHHHHHHHHHHHHHHHTGGGccTTTHHHHHHHHHHHHHHHTTccTTHHHHHHHHHHHccT:Sec Str 1501: . . . . + .:1560 :QHPATLSMRRRERGNADLHLNNL :Sequence :TcHHHHHHHHHHHHHHHHTccc :Sec Str