[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54441.1 tfus0 AAZ54441.1 "hypothetical protein"
MTSRRSHETPQGPDPRSPGAAPAYREAPPALTGRELADAVYLAAWQQHTAQHPPARPSGG
KDTALYAPSRVRGALLARPSQQRHDPKRRRHRVRGALLARPSGGKDTAPAAGPQRPGTDP
SAAVLGAAEKTAGTEPPRLPPAPAPPSGALRPHPSPLLHRSALYQALRPFRLAATDPWQH
SYDAEETARGYARRLLASPHPGGGHRPVAVTPQWAPFVRPGVQLTVLVDESVSMLFHQDQ
VNDFIGLVRSSGVFRGVRVERFTSDSADPAPVPAAGWGASSGKDPGGIHIAVVLSDGIGE
GWARGSVQSWLGCLAQRLPVAIIHLLDPRQWSRTGIRPAAMELTVAAHLGRAPANRHYTA
RPFQWPDGLPLPEPEFPHSALSVVLPVLASRPEMIHAWARFVMGTRQRTLNAGALRVVPG
DTAANAAGERPTAAPTPEARVRRFRRDSSETAFQIAVDLAAVPLTEPVIAAVCQRFAGHP
QPSELIEVLFSGLVTEVDSPVVTPERRIRWEYRRGVREALLSLGGRRSRIRRTLADIAAE
FAGYDPWFALLRRILDDSPVGELPELDETSLRLAADTLPALESIGLADLHHGLVYRIKEQ
MLAHQGAGHPDDWSDTLLEIAPTGPLVPGSSGQHGTTASERVPHAPHPTETPSNSASDES
SMMSQRSVSISDNFPGGSGSTGIGAGRNTSLSAIWGGDIPPRNALFTGRDDLILRLREQL
RSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRFRDEYDLVWWVRGGQTHQIHEAYTLLAQ
ELDVFRDNTSINSTIHSVREALRRGKPRSRWLLIFDDVRQPDDIMRYLPIAGPGHVIITT
RNLTWPEGGYFKTLPVEVFSLQESVALLSKCGLVGFSKHEAAELAEELGHMPIALRQAAA
WMNDSATTIAEYLEFYRDKQAQLAPMFAPADPDYPETVITALNVSLDRLAVTNPAALQLL
QVCSFFSTAPIPRSLFRHAQDVAAPPELEAALQEPNKLHRAFSDIGRYGLAVLNHRTRTV
QVHRLVQQALRVPLTADDQEQRRHCAHLLLAKNDPQDTSSPGARIRYAQLLPHVWATEAW
DCTDSWVRRLVLQEIYVTDLRGEHSDSKQLAEATLSVWREKLGKTAPETLRAELYLVRAL
RNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFVRDLRYAGRFHDSVELARDTRD
RYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVD
GYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKI
SGEVWRETKDRFGEDSMIAVVAAANHAAALRSVNRYHEALDLVEKAYRRCAELLGEDHPH
VAAINVNRAVVLRQMGRTEEARVIDERALQVLTDRLGEYHTSTLSSALNLASDFFGLDDV
AESVRRDTETLARCRRALSERHPLTLLARRNLVLGRKAMNEDVAEEIAAVERLYAEVMGD
QHPATLSMRRRERGNADLHLNNL
//