[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54462.1"

            "transcription-repair coupling factor"
            ""

OrgPattern ------------------------11111--1------------------------------------ 2223332222222222333-33223233333233332233333333333223333233222233332233332333223332221232222232222--2222222222211111111112222122222222222333224433423323322233222222222233223322333332232222232223333333333333333322333333333333333333333233333333333332333333323233233233333333333333333333333333333333333333333333333333344222333322322333334333322223222332223232222234231222233222323222232222223332232232233323333333-33333333322233322223432323222222223322222222222333442222222222211--2212222222222111113233222222222222222222222222222232222222222232222222232222222222222222222322212122222121122333333323333322111222222222222222222232222222233222232322222222322222222321-22222-1111133232323333333333-33333333333333333333333323233333333333333332333333321222222222222--32222223333222223222332222232233333432222222222233323333233322222222234442222223334322222222222222221222222222222222222---1---------------------2232222222312 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------1-1-12A2231-1224-22111---1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPHVLRPLRAGRPSSHAPPGDMSLNGLLSVVTGDPALKRAIETARNGHDPLLDLVAPPSV:Sequence : HHHHHHHHHHTTccEEEEEEcTTcc:Sec Str 61: . . . * . .: 120 :RPLIVAGLAADAPVGAGRPVLALTATEREAADLNSALGSLLPADSVALFPAWETLPHERL:Sequence :HHHHHHHHHHHHcHHHcccEEEEcccHHHHHHHHHHHHHHccccEEEEEccTcccccccE:Sec Str : ==========================================================:RP:SCP|63->328|2b2nA1|4e-44|25.3|249/308|c.37.1.19 : ==========================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 121: . . + . . .: 180 :SPRSDTVGQRLAVLRRLTHPDPDDPLTAPLRVVVAPIRSVLQPLVSGLGDLQPVRVREGD:Sequence :ETTTTEEccccccHHHHHHHHHHHTTTcccEEEEEcGGGGccccccTTTccccEEEEccc:Sec Str :============================================================:RP:SCP|63->328|2b2nA1|4e-44|25.3|249/308|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 181: . * . . . .: 240 :SVALDELVQSLVDIGYSRVDLVEKRGDIAVRGGILDVFPPTEEHPLRLEFWGDTVEEIRY:Sequence :cccTTTHHHHTTTTTcccccccccccccccccTTccccEEcccTTcccccEEEccccccE:Sec Str :============================================================:RP:SCP|63->328|2b2nA1|4e-44|25.3|249/308|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 241: + . . . . *: 300 :FQVADQRSISKPGAAEAGLFAPPCRELLLTDTVRKRARALAAEYPALADILTKLADGVAV:Sequence :EEcccccccccEcccEEEEcEcccccccccHHHHHHHHTTccccccTTcHHHHHHTTccc:Sec Str : XXXXXXXXXXXXX :SEG|276->288|raralaaeypala :============================================================:RP:SCP|63->328|2b2nA1|4e-44|25.3|249/308|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 301: . . . . + .: 360 :EGMEAFAPVLADRMELLLDLLPPGTHIVGCDPERIRTRAQELVATSQEFLEASWINAASG:Sequence :TTGGGGGGGcccccccGGGGccTTcEEE EEcccHHHHHHHHHHHHHHHHHH :Sec Str : XXXXXX :SEG|316->321|llldll :============================ :RP:SCP|63->328|2b2nA1|4e-44|25.3|249/308|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 361: . . . * . .: 420 :GEAPIDLGASAYQSIAELRSRARELGLPWWTVTPFDPGNPAAAEDDHSVVVGASATDAYR:Sequence : :Sec Str : ===:RP:SCP|418->508|2eyqA2|7e-11|24.4|90/117|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 421: . . + . . .: 480 :GDTERAIADVKSWLHEGWRVVLLTPGQGPAERLASMLRDAGLGTQLRDALPEPPEPAVAT:Sequence : EEEEEccHHHHHHHHHHHTTTTcccccccccccccccc cc:Sec Str :============================================================:RP:SCP|418->508|2eyqA2|7e-11|24.4|90/117|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 481: . * . . . .: 540 :VTTGLLEHGFVWRSVRTVLLTETDLVGQRSSTRDMRRMPSRRRGVDPLQLKPGDYVVHEQ:Sequence :EEEccccccEEETTTTEEEcccTTTcccccccccTTccccccHHHTTccccTTcEEEETG:Sec Str : XXXXXXXXXXXXXXX :SEG|509->523|rsstrdmrrmpsrrr :============================ :RP:SCP|418->508|2eyqA2|7e-11|24.4|90/117|c.37.1.19 : ============:RP:SCP|529->602|2eyqA1|5e-24|41.2|68/80|b.34.18.1 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 : $$$$$$$$$$:RP:PFM|531->629|PF02559|8e-20|51.6|93/100|CarD_TRCF 541: + . . . . *: 600 :HGIGRYVEMVSRTIQGATREYLVIEYAPSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLS:Sequence :GcEEEEEEEcccEETTEEEEEETTTccEEEcccTTcEEEEEEEccccccEEEEEcEEEEG:Sec Str :============================================================:RP:SCP|529->602|2eyqA1|5e-24|41.2|68/80|b.34.18.1 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|531->629|PF02559|8e-20|51.6|93/100|CarD_TRCF 601: . . . . + .: 660 :KMGGSDWAKAKSRARKAVREIAGDLIRLYSARHASPGHAFSPDTPWQRELEDAFPYVETP:Sequence :GGccHHHHHHHHHHHHHHHHHHHHHTTccHHHHHTHHHHHHHHHHTTccGGGcHHHHHcc:Sec Str : XXXXXXXXXXXX :SEG|608->619|akaksrarkavr :== :RP:SCP|529->602|2eyqA1|5e-24|41.2|68/80|b.34.18.1 : ==========================================================:RP:SCP|603->835|2eyqA3|6e-76|49.4|233/233|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|531->629|PF02559|8e-20|51.6|93/100|CarD_TRCF 661: . . . * . .: 720 :DQLAAIEEVKRDMEKPVPMDRLICGDVGYGKTEVAVRAAFKAVQDGKQVAVLVPTTLLVQ:Sequence :cHHHHHHHHHTTTcTTTcETEEEEccTTccHHHHTHHHHHHHTTccccEEEEEccHHHHH:Sec Str :============================================================:RP:SCP|603->835|2eyqA3|6e-76|49.4|233/233|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|680->822|PF00270|5e-07|34.1|138/167|DEAD 721: . . + . . .: 780 :QHLSTFTERYASFPVTVRPLSRFQSDAEIERIREGMRTGEVDVVIGTHRLLSPETQFKDL:Sequence :HHHHTTHHHHHHTTccEEEccTTccHHHHHHHHHccEEEEEHHHHHHHHHHHHTcccGGH:Sec Str :============================================================:RP:SCP|603->835|2eyqA3|6e-76|49.4|233/233|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|680->822|PF00270|5e-07|34.1|138/167|DEAD 781: . * . . . .: 840 :GLVIIDEEQRFGVEHKEALKRLRTQVDVLSMSATPIPRTLEMGLTGIREMTTILTPPEER:Sequence :HHTTcccccEEccEEccTTTGGGcccEEEEEEccccTTccHHHHHcccEEEEcccccccc:Sec Str :======================================================= :RP:SCP|603->835|2eyqA3|6e-76|49.4|233/233|c.37.1.19 : =====:RP:SCP|836->1045|2eyqA5|3e-72|53.3|210/211|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|680->822|PF00270|5e-07|34.1|138/167|DEAD 841: + . . . . *: 900 :HPVLTFVGPYDEKQIAAAIRRELMREGQVFFVHNRVASIERAAATVSRLVPEARVAWAHG:Sequence :cEEcccEEEccHHHHHHHHHHHHHHHHHHTccEEEEcccHHHHHHHHHHHHHTcccEEcc:Sec Str :============================================================:RP:SCP|836->1045|2eyqA5|3e-72|53.3|210/211|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 : $$$$$$$:RP:PFM|894->964|PF00271|7e-06|34.3|70/76|Helicase_C 901: . . . . + .: 960 :QMNEHQLERVMVDFWEKKFDVLVCTTIVESGLDVPNANTLIVDRADTYGLAQLHQLRGRV:Sequence :ccHHHHHHHHTTTTccccEEEEcTTccTTccccTTccTHHHHTTcccccTTTTHHHHTTH:Sec Str :============================================================:RP:SCP|836->1045|2eyqA5|3e-72|53.3|210/211|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|894->964|PF00271|7e-06|34.3|70/76|Helicase_C 961: . . . * . .:1020 :GRGRERAYAYFLYPPDKPLTETAHERLATVAQHTESGAGMYVAMKDLEIRGAGNILGTEQ:Sequence :HHHHHHHHHTTccEEcccTTHHHHHHHTccGGGcccEEEEEEEHHHHccccccccccHHH:Sec Str :============================================================:RP:SCP|836->1045|2eyqA5|3e-72|53.3|210/211|c.37.1.19 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 :$$$$ :RP:PFM|894->964|PF00271|7e-06|34.3|70/76|Helicase_C 1021: . . + . . .:1080 :SGSIAGVGFDLYVRMVGEAVRELKGDQSAAQEVETKVELPINAHIPHDYVPGERLRLEAY:Sequence :HHHHHHTcccccHHHHHHHHHTTHccccHHHHHHHHHHHHHTTcccccccGGGGGGGGGG:Sec Str :========================= :RP:SCP|836->1045|2eyqA5|3e-72|53.3|210/211|c.37.1.19 : =====================================:RP:SCP|1044->1202|2eyqA6|1e-30|20.8|154/158|d.315.1.1 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 : $$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1058->1138|PF03461|4e-18|44.4|81/101|TRCF 1081: . * . . . .:1140 :RRIAEVASEDDIAAIREELLDRYGEPPQPVDNLLAVARFRVLARSAGLTDVVLQGTQIRF:Sequence :GGccccTTEEcccccccccccEEcccHHHHHHHHHHHTTcccccHHHHHHH :Sec Str :============================================================:RP:SCP|1044->1202|2eyqA6|1e-30|20.8|154/158|d.315.1.1 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1058->1138|PF03461|4e-18|44.4|81/101|TRCF 1141: + . . . . *:1200 :APVELRESQQLRLRRLYPKAVVKAATRTLMVPVPKSGGLGGKQLRDRELLTWCTELVEAI:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|1144->1156|elresqqlrlrrl :============================================================:RP:SCP|1044->1202|2eyqA6|1e-30|20.8|154/158|d.315.1.1 :============================================================:BL:SWS|79->1200|MFD_MYCTU|0.0|55.8|1109/1234 1201: . . . . + .:1260 :FEPQRKPPQE :Sequence : :Sec Str :== :RP:SCP|1044->1202|2eyqA6|1e-30|20.8|154/158|d.315.1.1