[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54538.1"

            "Tyrosine protein kinase:Serine/threonine protein kinase"
            ""

OrgPattern -----------------1111-1-1--3---------------31-1----------4---1--1--- 4Q*4f34333333356799-9A33MC99999AABBCH7VL3oSt46735545669434227783MDISRQL555545512128-------2-----------------1-111111121222222--------2--877FH---L2U7DDAA98944------746BIHHK------------3344411211111111111111111111111111111121-111112111111111-1111111111111111111211111111111-11111111111111111111111111111111111111111111111111121122111111111121111111112111141111122111211111---S-Z1---------4311---21111------------1111-3-1-2---11111------11-3--111-11--1111111111----2---------------------------------1-------2111111-2221--322222121-1212--1---7642222333212523321-----------48619141--------1----2----1FFHFv*-3-----------------------1------1171-2---1---21----2------1------2--------------------------------------------------------------1-1---------------------------1---------1-A---------------------------24222221234111132-1-------------1------1-----2-3--111------2---11--------------------1--1-----1---1-----1---------43 A6CE***1*rpYcmyOQKNORSPNNQNNNLNANPOMKPLNJONRJLOOSUQRUSMQNIQQSSURQNOO8NTOOQNQUHTUNONNPPWW-TjRQQWVPIOPRNQ***5**g********ptp*****o*k***R***s*qr*m***m**jh*ef*x****w*****wV*gu****uG**i*WSP*i****Q**Lb***** --------------------------------------------------------------------------------------------------------------------------------------------------------------------------3----

Master   AminoSeq   


1: . . . . + .: 60 :MPAASQDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDGAR:Sequence : TGHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|38->53|llgrlgqggqgvvylg : ====:RP:SCP|57->278|1nw1A|2e-24|7.7|222/365|d.144.1.8 : =====================================:BL:SWS|24->291|PKWA_THECU|5e-46|38.4|268/742 : $$$:RP:PFM|58->283|PF00069|7e-31|34.7|225/256|Pkinase 61: . . . * . .: 120 :VAVKTLHRDALDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSL:Sequence :HHHHHHHHHHHHHTTTcccccccccEEEEETTEEEEEccTTEEEHHHHHTccccTTcccc:Sec Str :============================================================:RP:SCP|57->278|1nw1A|2e-24|7.7|222/365|d.144.1.8 :============================================================:BL:SWS|24->291|PKWA_THECU|5e-46|38.4|268/742 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|58->283|PF00069|7e-31|34.7|225/256|Pkinase 121: . . + . . .: 180 :QAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGGPRVIDFGIAR:Sequence :TTHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHTcccccGGGEEETTccEEEccccccc:Sec Str : ############# :PROS|154->166|PS00108|PROTEIN_KINASE_ST|PDOC00100| :============================================================:RP:SCP|57->278|1nw1A|2e-24|7.7|222/365|d.144.1.8 :============================================================:BL:SWS|24->291|PKWA_THECU|5e-46|38.4|268/742 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|58->283|PF00069|7e-31|34.7|225/256|Pkinase 181: . * . . . .: 240 :ALEGTAILTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAV:Sequence :ccccccHHHHHHTTcccHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHcccccTTTTHH:Sec Str :============================================================:RP:SCP|57->278|1nw1A|2e-24|7.7|222/365|d.144.1.8 :============================================================:BL:SWS|24->291|PKWA_THECU|5e-46|38.4|268/742 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|58->283|PF00069|7e-31|34.7|225/256|Pkinase 241: + . . . . *: 300 :VQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEPSTDTA:Sequence :HHHHTTTTccHHHHHHHHHHHHHHHHHHTTHHHHHHHHTTcHHTHHHHHTTccccccHHH:Sec Str :====================================== :RP:SCP|57->278|1nw1A|2e-24|7.7|222/365|d.144.1.8 :=================================================== :BL:SWS|24->291|PKWA_THECU|5e-46|38.4|268/742 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|58->283|PF00069|7e-31|34.7|225/256|Pkinase 301: . . . . + .: 360 :IPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHSNVAAQPSPTPPPHPQTASGP:Sequence :HHccEEEHHHHHHHH :Sec Str : XXXXXXX :SEG|332->338|ppapppp : XXXXXXXXXXXXXXXXXX:SEG|343->362|aaqpsptppphpqtasgpqp 361: . . . * . .: 420 :QPSLPSTGAQHSGYGYATGPHQSGYGYATGPQQGGYAPPPGPHQHAYPTPHSGNAAIPPH:Sequence : :Sec Str :XX :SEG|343->362|aaqpsptppphpqtasgpqp : XXXXXXXXXXXXXXXXXXXXXXX :SEG|388->410|atgpqqggyapppgphqhayptp 421: . . + . . .: 480 :GGPSGPYAPAQPWMPSTGGYPQTSQPYSGQQYQQQAEGTSTAFVLGVVSIAVIAGVLLFI:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|440->461|ypqtsqpysgqqyqqqaegtst : XXXXXXXXXXX:SEG|470->487|iaviagvllfillfllig 481: . * . . . .: 540 :LLFLLIGSLG :Sequence : :Sec Str :XXXXXXX :SEG|470->487|iaviagvllfillfllig