[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54591.1"

            "acetolactate synthase large subunit"
            ""

OrgPattern 11-1--4654454553-31221142--21111243112222221312213343111-----1321-11 4351532122212234744-432269444445243443CB1213122-122155653211435145976521222111-211311111222112---11--111142211---------------21111111111222331111632323322211113111222332421111111211111211111-123333333441353435223333334224242-3333332523333333333333323333122144112-2662234333134323111----22222222222222-------------211222111122-24-------4-321331---1-2--2122165222121221112--1-112112-11-1129561147346433333332315-55844A39662-4332359764786413158842245573333333321112332-----------------------------3324226C98845555454444669B76764674D676623333332226245A63333111311111111111422-922212233233511113112433222132521111111111-1-------1111221322231312222222322222222322233-1-211111111145542545666576766-6646766656666665664556542245455545555555553565666651-54444443444411---1-------32741222212-121-2112222221212222777748344578622222----1---313243333322222222222222211111111331122--------------------------------------1--1-111121 ----22--------153213233444622222222212121222332212113111221111211112-1231112212221111122-11132111111111122-23-4232224222222-242728N2-32422222125212212211421123474143211122234111118111234135123112111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGSPSFSGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHE:Sequence : cccHHHHHHHHHHHTTccEEEEcccGGGHHHHTTccTTHHTcEEEEcccH:Sec Str : ===============================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 : ==================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->173|PF02776|3e-22|38.4|159/170|TPP_enzyme_N 61: . . . * . .: 120 :QTAVFAAEAVGKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQG:Sequence :HHHHHHHHHHHHHHTccEEEEEEHHHHHHHTHHHHHHHHHHTccEEEEEEEccHHHHTTT:Sec Str :============================================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->173|PF02776|3e-22|38.4|159/170|TPP_enzyme_N 121: . . + . . .: 180 :LLQELDQSPLFTTITKRAWTVHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDRLYDQAE:Sequence :TTccTTGGGTTTTcccEEEccccGGGHHHHHHHHHHHHHccccccEEEEEEGGGTTcccc:Sec Str :============================================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->173|PF02776|3e-22|38.4|159/170|TPP_enzyme_N 181: . * . . . .: 240 :ITVTGQAAAEDRSPDPDAVAAVARLLSEAERPVLVYGSDVWLDHAEQAALEAAEELGVPV:Sequence :GGGTTccccccccccHHHHHHHHHHHHHccccEEEEcHHHHHHTcHHHHHHHHHHHTccE:Sec Str : XXXXXXXXXXXX :SEG|225->236|aeqaaleaaeel :============================================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|203->331|PF00205|4e-07|30.7|127/138|TPP_enzyme_M 241: + . . . . *: 300 :VTNGQGRGVLPAGHPLLATRARGLALGRADLVIVVGTPLDFRLNHGLFGGRDGAPLARTV:Sequence :EEcccccccccTTcTTEEEEccccHHHHHcEEEEEcccTTccccccccccccccTTcEEE:Sec Str : XXXXXXXXXXXXXX :SEG|256->269|llatrarglalgra :============================================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|203->331|PF00205|4e-07|30.7|127/138|TPP_enzyme_M 301: . . . . + .: 360 :HITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREVAQWRTEVAEAAAATAAKDRE:Sequence :EEEccHHHHHHcccccEEEEccHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccc:Sec Str : XXXXXXXXXXXX :SEG|345->356|tevaeaaaataa :============================================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|203->331|PF00205|4e-07|30.7|127/138|TPP_enzyme_M 361: . . . * . .: 420 :VLDSDASPIHPARIYGELNRILDDDAVVIGDGGDFVSYAGKYIQPRRPGNWLDPGPFGCL:Sequence :ccccccccccHHHHHHHHHHHccTTcEEEEEcGGGHHHHHHHcccccTTcEEEcTTccTc:Sec Str : XXXXXXXXXXXXXX :SEG|383->396|dddavvigdggdfv :============================================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 : $$$$$$$$$$$$$$:RP:PFM|407->536|PF02775|2e-17|38.0|129/139|TPP_enzyme_C 421: . . + . . .: 480 :GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKA:Sequence :ccHHHHHHHHHHHcTTccEEEEEEHHHHTTTGGGHHHHHHHTcccEEEEEEccccHHHHH:Sec Str : #################### :PROS|428->447|PS00187|TPP_ENZYMES|PDOC00166| :============================================================:RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|407->536|PF02775|2e-17|38.0|129/139|TPP_enzyme_C 481: . * . . . .: 540 :PMQLVYGYDVLADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVNIVT:Sequence :HHHHTTcccccccccccccHHHHHHHTTcEEEEEccHHHHHHHHHHHHHccccEEEEEEc:Sec Str :======================================== :RP:SCP|14->520|1fp4B|4e-33|7.3|478/522|c.92.2.3 :============================================================:BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|407->536|PF02775|2e-17|38.0|129/139|TPP_enzyme_C 541: + . . . . *: 600 :DPENVYPRKTMGV :Sequence :cccccTTccccTG :Sec Str :========== :BL:SWS|11->550|ILVG_MYCTU|e-110|44.0|532/547