[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54591.1 tfus0 AAZ54591.1 "acetolactate synthase large subunit"
MGSPSFSGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHE
QTAVFAAEAVGKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQG
LLQELDQSPLFTTITKRAWTVHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDRLYDQAE
ITVTGQAAAEDRSPDPDAVAAVARLLSEAERPVLVYGSDVWLDHAEQAALEAAEELGVPV
VTNGQGRGVLPAGHPLLATRARGLALGRADLVIVVGTPLDFRLNHGLFGGRDGAPLARTV
HITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREVAQWRTEVAEAAAATAAKDRE
VLDSDASPIHPARIYGELNRILDDDAVVIGDGGDFVSYAGKYIQPRRPGNWLDPGPFGCL
GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKA
PMQLVYGYDVLADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVNIVT
DPENVYPRKTMGV
//