[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54627.1"

            "ABC-type cobalt transport system"
            ""

OrgPattern -------------------------------------------------------------------- ------1-111-1--------1---1-------111---------------111-1----11-1------11111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNLTSAPAGRAAPGNGQPGVRSWLLGINPAAKLIAACVISFGLIPAVDPVTGGIVLAVTA:Sequence 61: . . . * . .: 120 :LLLPFSGINRATLLVLSVPFCLMGLSTWVVNLLYGEEGLWGASGAAVRILAIALPGMLAA:Sequence 121: . . + . . .: 180 :VSSDATDLADALVQRLKVPERPAMGVLAALRLVPLLADQWRTVTLARRARGLEAGRNPLA:Sequence : XXXXXXXXXXXX :SEG|146->157|vlaalrlvplla : XXXXXXXXXXXX :SEG|165->176|larrargleagr 181: . * . . . .: 240 :ALSIFFGKLFALLVRAVRTGTLLATAMDARAFGTGPRSHARVSRWRLADTVLVAASLLLL:Sequence : XXXXXXXXXXXXXX:SEG|227->248|ladtvlvaasllllaaaytvsa 241: + . . . . *: 300 :AAAYTVSAQLGTLRLLFT :Sequence :XXXXXXXX :SEG|227->248|ladtvlvaasllllaaaytvsa