[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54630.1"

            "Tyrosine protein kinase:Serine/threonine protein kinase"
            ""

OrgPattern ------1------1----11111-1--4---------------3--12-------1-6---1--1--- 4T*4h54444454369ABB-BB44NDBBBBBBBCCDI7XM3oRu56735545658434227793MEISQRL544456612147-1-----2--1--1-----------1-211111122222222--1-----2--988JL---U2XCFG77B7844------667BOLPO------------45544112121111111212111111111111111122111111112122111111-1111111111111111111111111111111-11111111111111111111111111111111111111111111111111111122111111111121111111111111141111122111211111---T-j1---------4311---11--1------------1111-3-1-2-----1-1------11-4--211-11--1111111111-------------------------------------11-------1111111-2221--112222122-12231-1111764223233322263343------------4961A3431---1-11-----2----1EEFD**-3-----------------------1------1172-3-2-1---1211112-111-23------2-------1-------------2-----------1----------------------------2-2---------------------------3---------11B12-------------------------1533342123411113211----------2222-----12-22--3-3--111----112---1111---------------1-11--11----11-111----1---------54 IDBF***3***dmy*YTOQWVWTSSTPONSTCSVXSORNSNPSQKOSSaZYVWWOWYPTVXVbZZYYZHUeZYYYceOaeXXVXZbbb-kufTejlXPUXVRV***B*************t*****u*y***V*****zx*w*********ti*************X********L**m*fbd*p****P**Up***** --------------------------------------------------------------------------------------------------------------------------------------------------------------------------41---

Master   AminoSeq   


1: . . . . + .: 60 :MAMAAGFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIA:Sequence :GccccHTccTcTTcTcccGEEEEEccTTccccccEEEEEEEcHHHHHHHHHHHHHHHTTT:Sec Str : ####################### :PROS|26->48|PS00107|PROTEIN_KINASE_ATP|PDOC00100| : =========================================:RP:SCP|20->264|1nw1A|2e-34|5.3|245/365|d.144.1.8 : ===============================================:BL:SWS|14->267|PKWA_THECU|6e-51|40.6|254/742 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->263|PF00069|4e-35|37.0|235/256|Pkinase 61: . . . * . .: 120 :RARLAREVMTMRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTLDSTVTNHGPLRGRALT:Sequence :cccccccccEEEEETTEEEEEccTTEEEHHHHHTccccTTccccTTHHHHHHHHTcccHH:Sec Str :============================================================:RP:SCP|20->264|1nw1A|2e-34|5.3|245/365|d.144.1.8 :============================================================:BL:SWS|14->267|PKWA_THECU|6e-51|40.6|254/742 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->263|PF00069|4e-35|37.0|235/256|Pkinase 121: . . + . . .: 180 :RVVTGLARALRDIHAAEIIHRDLKPGNVIICNGEPIIIDFGIAYAVDGSKLTQTGTFVGT:Sequence :HHHHHHHHHHHHHHHHHHTcccccGGGEEEETccEEEcccccccccccccHHHHHHTTcc:Sec Str : ############# :PROS|138->150|PS00108|PROTEIN_KINASE_ST|PDOC00100| :============================================================:RP:SCP|20->264|1nw1A|2e-34|5.3|245/365|d.144.1.8 :============================================================:BL:SWS|14->267|PKWA_THECU|6e-51|40.6|254/742 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->263|PF00069|4e-35|37.0|235/256|Pkinase 181: . * . . . .: 240 :PSYLSPEVIEGSDLSPATDIHAWGATVAFAATGNPPYGAGAFEVIFFRILNGEINLDGVP:Sequence :ccHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHcccccTTTTHHHHHHTTTTccHHHHH:Sec Str :============================================================:RP:SCP|20->264|1nw1A|2e-34|5.3|245/365|d.144.1.8 :============================================================:BL:SWS|14->267|PKWA_THECU|6e-51|40.6|254/742 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->263|PF00069|4e-35|37.0|235/256|Pkinase 241: + . . . . *: 300 :EPLRPIVQDAVQRDPRKRPTAEELVARTEQLNLDLPWMEDEYRSSGMTGLHTVSADLPTS:Sequence :HHHHHHHHHHHHHTTHHHHHHHHTTHcHHHHHHTcHHHHHcccccTcccccHH :Sec Str : XXX:SEG|298->322|ptstpqpappepeenqatavaeaaa :======================== :RP:SCP|20->264|1nw1A|2e-34|5.3|245/365|d.144.1.8 :=========================== :BL:SWS|14->267|PKWA_THECU|6e-51|40.6|254/742 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|24->263|PF00069|4e-35|37.0|235/256|Pkinase 301: . . . . + .: 360 :TPQPAPPEPEENQATAVAEAAAPDRTMVAPEGFGDDEEEQDSGRRYDHYYDATLRPEEFR:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXX :SEG|298->322|ptstpqpappepeenqatavaeaaa 361: . . . * . .: 420 :DILTPVDYEGRNRDSADYDDEPPSLLERFRAYRRGEDRLSDYFSDDEDDYYDEYEAKRLP:Sequence : :Sec Str : XXXXXXXXXXX :SEG|405->415|ddeddyydeye 421: . . + . . .: 480 :WVMVVPVALGIVGLTLMMPTIGLILGTLAVTVLGGLDLARREHARRLHERGPRSSDNVVI:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|442->470|glilgtlavtvlggldlarreharrlher 481: . * . . . .: 540 :ALSMPWALLRTLGHAALYGLGYLLAGIVVGIAIGMVSGNSSANVVGSWALGVVVLMNFLF:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|492->511|lghaalyglgyllagivvgi : XXXXXXXXXXXX :SEG|516->527|vsgnssanvvgs 541: + . . . . *: 600 :GPHARGAQRQSRWLVSKITIRNPYVYWGTIIAISLLALFLVVFGVQLVPAWDPIPGPSEW:Sequence : :Sec Str 601: . . . . + .: 660 :FGS :Sequence : :Sec Str