[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54630.1 tfus0 AAZ54630.1 "Tyrosine protein kinase:Serine/threonine protein kinase"
MAMAAGFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIA
RARLAREVMTMRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTLDSTVTNHGPLRGRALT
RVVTGLARALRDIHAAEIIHRDLKPGNVIICNGEPIIIDFGIAYAVDGSKLTQTGTFVGT
PSYLSPEVIEGSDLSPATDIHAWGATVAFAATGNPPYGAGAFEVIFFRILNGEINLDGVP
EPLRPIVQDAVQRDPRKRPTAEELVARTEQLNLDLPWMEDEYRSSGMTGLHTVSADLPTS
TPQPAPPEPEENQATAVAEAAAPDRTMVAPEGFGDDEEEQDSGRRYDHYYDATLRPEEFR
DILTPVDYEGRNRDSADYDDEPPSLLERFRAYRRGEDRLSDYFSDDEDDYYDEYEAKRLP
WVMVVPVALGIVGLTLMMPTIGLILGTLAVTVLGGLDLARREHARRLHERGPRSSDNVVI
ALSMPWALLRTLGHAALYGLGYLLAGIVVGIAIGMVSGNSSANVVGSWALGVVVLMNFLF
GPHARGAQRQSRWLVSKITIRNPYVYWGTIIAISLLALFLVVFGVQLVPAWDPIPGPSEW
FGS
//