[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54828.1"

            "putative membrane protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------1---------1-11---------11--1--1111---------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSIILRVIVNAIALWAAVLLVDGIEVSADTTVSTIATYLGIGALFGIVNAVIKPIVKTVG:Sequence : ===========================================================:BL:SWS|2->124|Y3922_STRCO|2e-13|30.1|123/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->116|PF04020|2e-04|33.0|106/106|DUF360 61: . . . * . .: 120 :CIFYYVTLGLVALVVNALLLWLTAWLAGVLGIPFEIDGFWAAFWGAIIVAIVSWLLSLFV:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|66->90|vtlglvalvvnalllwltawlagvl :============================================================:BL:SWS|2->124|Y3922_STRCO|2e-13|30.1|123/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->116|PF04020|2e-04|33.0|106/106|DUF360 121: . . + . . .: 180 :GKDDD :Sequence :==== :BL:SWS|2->124|Y3922_STRCO|2e-13|30.1|123/100