[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54828.1 tfus0 AAZ54828.1 "putative membrane protein"
MSIILRVIVNAIALWAAVLLVDGIEVSADTTVSTIATYLGIGALFGIVNAVIKPIVKTVG
CIFYYVTLGLVALVVNALLLWLTAWLAGVLGIPFEIDGFWAAFWGAIIVAIVSWLLSLFV
GKDDD
//