[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ54978.1"

            "signal transduction histidine kinase"
            ""

OrgPattern -------------------------------------------------------------------- ----9----------1111-11--1111111111117122-5462---1-----------74--585CCA6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------1---------1111-1111--1--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSTRATNNGADAKDDAPEQAEKTETTAKRPARRWDPRNWRVRSRLVALVVVPTAAALILG:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|40->59|rvrsrlvalvvvptaaalil 61: . . . * . .: 120 :VVRFSESALNTFRNERTEAMVTLAEDIVQLGNELGKERMLVAAYIADNPNPTRRSNDRAV:Sequence : :Sec Str : ======================:BL:SWS|99->255|SYS_SYNE7|3e-04|26.3|152/428 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|90->337|PF08376|1e-17|32.2|236/246|NIT 121: . . + . . .: 180 :ALQEQQKIVDQELNDVRAGANELGTPSDPLVKERLDIMLDSLEKLNGVREEVTSTRVTML:Sequence : :Sec Str :============================================================:BL:SWS|99->255|SYS_SYNE7|3e-04|26.3|152/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|90->337|PF08376|1e-17|32.2|236/246|NIT 181: . * . . . .: 240 :PAVTKYRQIISTLTDFVETLANATNTSSELRESVRALSALGRARDDQSYEAALMVHSLIR:Sequence : :Sec Str :============================================================:BL:SWS|99->255|SYS_SYNE7|3e-04|26.3|152/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|90->337|PF08376|1e-17|32.2|236/246|NIT 241: + . . . . *: 300 :DSMSGGVQDSIESTQARYNNEIRNFRNSATPAQEALLDENYGGLDVSRLGTMRLRALLRA:Sequence : :Sec Str :=============== :BL:SWS|99->255|SYS_SYNE7|3e-04|26.3|152/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|90->337|PF08376|1e-17|32.2|236/246|NIT 301: . . . . + .: 360 :DEGQPLTGITDGDDADSYQQTALSALDTLAKVESSLARMVRAEATAHKEQGRRLLLFDSI:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|90->337|PF08376|1e-17|32.2|236/246|NIT 361: . . . * . .: 420 :TVLFVVVFVFLTTSWVARSMVIPLRVLRDGAMRIAAKDLPEAIVRMRETNVRPEEVKITP:Sequence : cGGGHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHcccc:Sec Str :XXXXXXXXXXXXX :SEG|361->373|tvlfvvvfvfltt 421: . . + . . .: 480 :LEVDSSDEFGEVARSFDEVHRSALRLAADEAALRANVNAMFVNLSRRSQSLVERQLRLIE:Sequence :ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHT:Sec Str : XXXXXXXXXXXXXXX :SEG|441->455|rsalrlaadeaalra 481: . * . . . .: 540 :HLEQSEQDEERLAELFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRAAVSE:Sequence :TccHHHHTTTGGGHGTTccGGGcHHHHHHHHHHTcccGGGGTTTTTcHHHHHHHHHHHHc:Sec Str : ===============:RP:SCP|526->668|1id0A|2e-12|16.1|137/146|d.122.1.3 : =======================================================:BL:SWS|486->665|QSEC_ECO57|2e-09|32.0|172/449 541: + . . . . *: 600 :VEQYARVNVRAPSHVSVLGRPVNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIII:Sequence :ccHHHHHHHHHHTTccccTTccGGGHHHHHHHHHcTTTTHHHHHHHccccccEcccEEEE:Sec Str :============================================================:RP:SCP|526->668|1id0A|2e-12|16.1|137/146|d.122.1.3 :============================================================:BL:SWS|486->665|QSEC_ECO57|2e-09|32.0|172/449 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|563->668|PF02518|3e-07|35.6|101/112|HATPase_c 601: . . . . + .: 660 :EITDSGIGMSAEELESANQKLAEPPVIDVAVSRRMGLFVVSRLANRHGIEVRLRPAHNGG:Sequence :EEEEccccccHHHHHHHTcTTTTccccccccccccHHHHHHHHHHHTTcEEEEEEETTTE:Sec Str :============================================================:RP:SCP|526->668|1id0A|2e-12|16.1|137/146|d.122.1.3 :============================================================:BL:SWS|486->665|QSEC_ECO57|2e-09|32.0|172/449 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|563->668|PF02518|3e-07|35.6|101/112|HATPase_c 661: . . . * . .: 720 :ITAAVRLPNDLLITPVEPTPPALTSGRGTTVPDTYAEATAAFASSPAPADPADSVWEPRT:Sequence :EEEEEEEEccTTTcccccccccHHHHGGGcc :Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|692->714|pdtyaeataafasspapadpads :======== :RP:SCP|526->668|1id0A|2e-12|16.1|137/146|d.122.1.3 :===== :BL:SWS|486->665|QSEC_ECO57|2e-09|32.0|172/449 :$$$$$$$$ :RP:PFM|563->668|PF02518|3e-07|35.6|101/112|HATPase_c 721: . . + . . .: 780 :SNDRPVWEPRTTPSGLPKRPDPATRAAQQGQQTPPEHPPSGEDLWDAGWKRSVSRTTSPQ:Sequence : :Sec Str 781: . * . . . .: 840 :PVADRPETPRTETPRPETPRPETPRTETPRTESPADTTSTSAIPTVSDSRPSAADTVGSS:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|785->812|rpetprtetprpetprpetprtetprte 841: + . . . . *: 900 :RTGGQSVYGYSLDRPGQRSAHPLGDTRSSTSERQGWQQNPLSSSYSSGSGRTEQPEVREG:Sequence : :Sec Str : XXXXXXXXX :SEG|882->890|sssyssgsg 901: . . . . + .: 960 :YGSTAYLSKRYGPGSGNQNTIIPPSPEHESNEPLPIFDSIESNWFRRRTVRPAVTTTETG:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|946->959|rrrtvrpavtttet 961: . . . * . .:1020 :PISAVSTPDGLGTEPAAPAQQQSQQPRPEDEWRSAADAGWKTAAERASAPIAGGITASGL:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|975->986|paapaqqqsqqp 1021: . . + . . .:1080 :PKRIPRANLVPGAAPAPENFKQITSRSAERVRSRFSSFQQGIRQGRDALNKRSSQEE :Sequence : :Sec Str