[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ54978.1 tfus0 AAZ54978.1 "signal transduction histidine kinase"
MSTRATNNGADAKDDAPEQAEKTETTAKRPARRWDPRNWRVRSRLVALVVVPTAAALILG
VVRFSESALNTFRNERTEAMVTLAEDIVQLGNELGKERMLVAAYIADNPNPTRRSNDRAV
ALQEQQKIVDQELNDVRAGANELGTPSDPLVKERLDIMLDSLEKLNGVREEVTSTRVTML
PAVTKYRQIISTLTDFVETLANATNTSSELRESVRALSALGRARDDQSYEAALMVHSLIR
DSMSGGVQDSIESTQARYNNEIRNFRNSATPAQEALLDENYGGLDVSRLGTMRLRALLRA
DEGQPLTGITDGDDADSYQQTALSALDTLAKVESSLARMVRAEATAHKEQGRRLLLFDSI
TVLFVVVFVFLTTSWVARSMVIPLRVLRDGAMRIAAKDLPEAIVRMRETNVRPEEVKITP
LEVDSSDEFGEVARSFDEVHRSALRLAADEAALRANVNAMFVNLSRRSQSLVERQLRLIE
HLEQSEQDEERLAELFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRAAVSE
VEQYARVNVRAPSHVSVLGRPVNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIII
EITDSGIGMSAEELESANQKLAEPPVIDVAVSRRMGLFVVSRLANRHGIEVRLRPAHNGG
ITAAVRLPNDLLITPVEPTPPALTSGRGTTVPDTYAEATAAFASSPAPADPADSVWEPRT
SNDRPVWEPRTTPSGLPKRPDPATRAAQQGQQTPPEHPPSGEDLWDAGWKRSVSRTTSPQ
PVADRPETPRTETPRPETPRPETPRTETPRTESPADTTSTSAIPTVSDSRPSAADTVGSS
RTGGQSVYGYSLDRPGQRSAHPLGDTRSSTSERQGWQQNPLSSSYSSGSGRTEQPEVREG
YGSTAYLSKRYGPGSGNQNTIIPPSPEHESNEPLPIFDSIESNWFRRRTVRPAVTTTETG
PISAVSTPDGLGTEPAAPAQQQSQQPRPEDEWRSAADAGWKTAAERASAPIAGGITASGL
PKRIPRANLVPGAAPAPENFKQITSRSAERVRSRFSSFQQGIRQGRDALNKRSSQEE
//