[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55004.1"

            "caffeoyl-CoA O-methyltransferase"
            ""

OrgPattern ------------------------1111--11------------------1---------------11 122-2-----1---32433-331123333332222222111322-2-2-1113221-2--321-42122111----11----11-111111111111-111111111111--------------1-----------11122---1-2221111--11------11-23132--------------------11122222243233223322--2123311-221111111122---------------1111-1----------------------11111111111-11111111111111--1111-11111111111111-1111111111111111--1111-1111-11--1111--11--1111-11---1--------11111---22--1-----------------2---2--1----1-221---1--1----------11111111---1--111111111111---------------111111----------111-1-1111112-1111-11-----------------------1-----2-1111111111---1-----1--1------2--1-1--111111-1---1-----------------------11-------------------------------11---------1-----------------------------------111----------------------------------------------1111111111--1-2---------------2222222---1-2222-1--1--------122111212---------------111---------------11--21----------------------------------------------1-- ----32--------12---1-213-1-11-111111-------1111-2313122212-111----------1----------------111-1411111---113--548352232111212112-11151-111-11111121--11-21-223212---122-----1343511217111152686-93--21113 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQL:Sequence :HHcccTTccHHHHHHHHHTcccccHHHHHHHHHTTTcTTGGGcccccHHHHHHHHHHHHH:Sec Str : ==================================================:RP:SCP|11->173|1h1dA|7e-41|22.4|161/214|c.66.1.1 : =====================================================:BL:SWS|8->219|MDMC_STRMY|1e-43|43.1|211/221 : $$$$$$$$$$$$$$$$$:RP:PFM|44->214|PF01596|2e-42|49.1|171/191|Methyltransf_3 61: . . . * . .: 120 :IGARNIVEVGTFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRL:Sequence :HTccEEEEEccTTcHHHHHHHTTccTTcEEEEEEccHHHHHHHHHHHHHHTcGGGEEEEE:Sec Str :============================================================:RP:SCP|11->173|1h1dA|7e-41|22.4|161/214|c.66.1.1 :============================================================:BL:SWS|8->219|MDMC_STRMY|1e-43|43.1|211/221 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->214|PF01596|2e-42|49.1|171/191|Methyltransf_3 121: . . + . . .: 180 :APALDTLRALPEEPQFDLAFIDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPA:Sequence :cHHHHHHHTccccccEEEEEEcccGGGHHHHHHHHHHTEEEEEEEEEEcTTGGGGGGccc:Sec Str :===================================================== :RP:SCP|11->173|1h1dA|7e-41|22.4|161/214|c.66.1.1 :============================================================:BL:SWS|8->219|MDMC_STRMY|1e-43|43.1|211/221 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->214|PF01596|2e-42|49.1|171/191|Methyltransf_3 181: . * . . . .: 240 :QTAARVQAIRDFNVHARDDTRVDLVILPIGDGFTLARRR :Sequence :cccHHHHHHHHHHHHHTTcTTEEEEEEcccTcEEEEEEc :Sec Str :======================================= :BL:SWS|8->219|MDMC_STRMY|1e-43|43.1|211/221 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|44->214|PF01596|2e-42|49.1|171/191|Methyltransf_3