[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55025.1"

            "small multidrug resistance protein, SMR family"
            ""

OrgPattern ------------------------1--1---------------------11-1--------------- -1-------------1111-1211121111112---11----1--11--11----2------1-112-111-----------1-----------------1------------------------111-1-1121-11111----------------1111-1----111----------------------11222221211122112-2--21211-111--1------1---------------------1------------------1------------------------------------------------------------------------------1------11-------------1-------------1--1122211-11111111111-----1-1-----1---1111111122-1-1--1111111------------1-21---------------1----------------1--211121222212111122121111112111121-----1-1112-------1-2-11---11---1----111--------111-------1------11-1--------------------------11-1-11---311------21-----111-21---1----------1111-11111111211-2-12--1--221111111-1--1-222-----1--1------21---11111-22222221222211---1-------11--1111---1------1---1-4--11111----1--1-11122--------1----112-111112----1112121111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQWLLLIGAILTEVTGTISLRLSDGFTRLVPSLIALTSYGIAFTLLAQVLKLGMGVGVAY:Sequence : cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTcc ccccccc:Sec Str :============================================================:BL:SWS|1->84|MMR_MYCPA|5e-17|45.2|84/107 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->84|PF00893|5e-12|50.6|81/93|Multi_Drug_Res 61: . . . * . .: 120 :GIWSALGVTLVAVIGAVFLGDTLTWVQIVGIVLVIAGVAALELGAAR :Sequence :cHHHHHHHHHHHHHTTTTTcccc :Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|86->106|vqivgivlviagvaalelgaa :======================== :BL:SWS|1->84|MMR_MYCPA|5e-17|45.2|84/107 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->84|PF00893|5e-12|50.6|81/93|Multi_Drug_Res