[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55025.1 tfus0 AAZ55025.1 "small multidrug resistance protein, SMR family"
MQWLLLIGAILTEVTGTISLRLSDGFTRLVPSLIALTSYGIAFTLLAQVLKLGMGVGVAY
GIWSALGVTLVAVIGAVFLGDTLTWVQIVGIVLVIAGVAALELGAAR
//